BLASTX nr result
ID: Mentha23_contig00020721
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00020721 (358 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU44419.1| hypothetical protein MIMGU_mgv1a009413mg [Mimulus... 59 5e-07 emb|CAN65608.1| hypothetical protein VITISV_042270 [Vitis vinifera] 56 6e-06 >gb|EYU44419.1| hypothetical protein MIMGU_mgv1a009413mg [Mimulus guttatus] Length = 343 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -3 Query: 317 SVEGTWDACVERVADCYRQAGLDDIGTFILYK 222 SVEGTWDA V+RVA+CYR+AGL DI TFILYK Sbjct: 311 SVEGTWDASVDRVAECYREAGLHDIATFILYK 342 >emb|CAN65608.1| hypothetical protein VITISV_042270 [Vitis vinifera] Length = 270 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/33 (69%), Positives = 28/33 (84%) Frame = -3 Query: 317 SVEGTWDACVERVADCYRQAGLDDIGTFILYKD 219 SVEGTWD VER+A+CYR+AGL DI F+LY+D Sbjct: 238 SVEGTWDDFVERIAECYREAGLHDIARFVLYRD 270