BLASTX nr result
ID: Mentha23_contig00020719
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00020719 (318 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB30970.1| hypothetical protein L484_016828 [Morus notabilis] 55 8e-06 ref|XP_004301536.1| PREDICTED: pentatricopeptide repeat-containi... 55 1e-05 ref|XP_002514631.1| pentatricopeptide repeat-containing protein,... 55 1e-05 >gb|EXB30970.1| hypothetical protein L484_016828 [Morus notabilis] Length = 587 Score = 55.5 bits (132), Expect = 8e-06 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +1 Query: 46 LPEKMARKRRRLKQIRLSFVKKPKKTRRRS 135 LPEKMARKRRRLKQIRLSFVKKPKK RR+ Sbjct: 557 LPEKMARKRRRLKQIRLSFVKKPKKMTRRA 586 >ref|XP_004301536.1| PREDICTED: pentatricopeptide repeat-containing protein At5g60960, mitochondrial-like [Fragaria vesca subsp. vesca] Length = 517 Score = 55.1 bits (131), Expect = 1e-05 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +1 Query: 46 LPEKMARKRRRLKQIRLSFVKKPKKTRRRS 135 LPEKMARKRRRLKQIRLSFVKKPKK RR+ Sbjct: 487 LPEKMARKRRRLKQIRLSFVKKPKKGMRRA 516 >ref|XP_002514631.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223546235|gb|EEF47737.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 569 Score = 55.1 bits (131), Expect = 1e-05 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = +1 Query: 46 LPEKMARKRRRLKQIRLSFVKKPKKTRRR 132 LPEKMARKRRRLKQIRLSFVKKPKK RR Sbjct: 539 LPEKMARKRRRLKQIRLSFVKKPKKMMRR 567