BLASTX nr result
ID: Mentha23_contig00019253
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00019253 (461 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU45389.1| hypothetical protein MIMGU_mgv1a001172mg [Mimulus... 58 2e-06 >gb|EYU45389.1| hypothetical protein MIMGU_mgv1a001172mg [Mimulus guttatus] Length = 873 Score = 57.8 bits (138), Expect = 2e-06 Identities = 33/64 (51%), Positives = 40/64 (62%) Frame = +3 Query: 3 ETNDTESKNNENVKETAAPEEEGDDYEETKDASTKKRKTRKSGDTKQKKSKVAYVSAMAI 182 E T K + AAP GDD E++D KKRK+RKS D KQKK+KVAYVSA A+ Sbjct: 811 EKKSTVDKGEKKKLNDAAPNT-GDDDMESEDIPVKKRKSRKSQDRKQKKAKVAYVSASAV 869 Query: 183 SSPA 194 S+ A Sbjct: 870 STHA 873