BLASTX nr result
ID: Mentha23_contig00018990
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00018990 (318 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU41212.1| hypothetical protein MIMGU_mgv1a000056mg [Mimulus... 56 6e-06 >gb|EYU41212.1| hypothetical protein MIMGU_mgv1a000056mg [Mimulus guttatus] Length = 2013 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/38 (71%), Positives = 32/38 (84%) Frame = -1 Query: 114 DIHAHWLQWKISQAYGQNIDSQKSKELAEAILPILAEG 1 DI A+WLQ KISQAY QNID Q+S++LAE +L ILAEG Sbjct: 274 DIDAYWLQRKISQAYDQNIDPQQSQKLAEEVLKILAEG 311