BLASTX nr result
ID: Mentha23_contig00018823
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00018823 (937 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006351815.1| PREDICTED: glycine-rich RNA-binding protein ... 108 2e-21 ref|XP_004230614.1| PREDICTED: uncharacterized protein LOC101263... 108 2e-21 ref|XP_004136860.1| PREDICTED: uncharacterized protein LOC101215... 105 3e-20 gb|ACX71299.1| RNA-binding protein RZ-1 [Capsicum annuum] 105 3e-20 dbj|BAA12064.1| RNA-binding protein RZ-1 [Nicotiana sylvestris] ... 102 2e-19 emb|CBI35498.3| unnamed protein product [Vitis vinifera] 102 2e-19 ref|XP_002523766.1| dc50, putative [Ricinus communis] gi|2235369... 102 2e-19 ref|XP_002264022.1| PREDICTED: uncharacterized protein LOC100256... 102 2e-19 ref|XP_006341831.1| PREDICTED: glycine-rich RNA-binding protein ... 102 2e-19 ref|XP_002299678.2| hypothetical protein POPTR_0001s21460g [Popu... 100 6e-19 ref|XP_004248805.1| PREDICTED: uncharacterized protein LOC101246... 100 6e-19 ref|XP_006291770.1| hypothetical protein CARUB_v10017941mg [Caps... 100 8e-19 ref|XP_002875318.1| predicted protein [Arabidopsis lyrata subsp.... 100 8e-19 ref|XP_006854598.1| hypothetical protein AMTR_s00030p00132070 [A... 100 1e-18 ref|XP_007037359.1| RNA-binding family protein with retrovirus z... 100 1e-18 ref|XP_007037358.1| RNA-binding family protein with retrovirus z... 100 1e-18 ref|NP_189273.1| zinc finger-containing glycine-rich RNA-bindin... 99 2e-18 ref|XP_004504757.1| PREDICTED: glycine-rich RNA-binding protein-... 99 2e-18 ref|XP_006395557.1| hypothetical protein EUTSA_v10004793mg [Eutr... 99 2e-18 gb|AAL09710.1| AT3g26420/F20C19_14 [Arabidopsis thaliana] gi|196... 99 2e-18 >ref|XP_006351815.1| PREDICTED: glycine-rich RNA-binding protein GRP2A-like isoform X1 [Solanum tuberosum] gi|565370415|ref|XP_006351816.1| PREDICTED: glycine-rich RNA-binding protein GRP2A-like isoform X2 [Solanum tuberosum] Length = 205 Score = 108 bits (271), Expect = 2e-21 Identities = 49/57 (85%), Positives = 55/57 (96%) Frame = +3 Query: 765 MGDQDEFRCFIGNLSWSTSDRGLKQAFEKFGHLVEAKVVLDKFSGRSRGFGFVSFEE 935 M ++DE+RCFIGNLSWSTSDRGLK AFEKFGHLV+AKVVLDKFSGRSRGFGFV+F+E Sbjct: 1 MSEEDEYRCFIGNLSWSTSDRGLKDAFEKFGHLVDAKVVLDKFSGRSRGFGFVTFDE 57 >ref|XP_004230614.1| PREDICTED: uncharacterized protein LOC101263853 isoform 1 [Solanum lycopersicum] gi|460369530|ref|XP_004230615.1| PREDICTED: uncharacterized protein LOC101263853 isoform 2 [Solanum lycopersicum] Length = 202 Score = 108 bits (271), Expect = 2e-21 Identities = 49/57 (85%), Positives = 55/57 (96%) Frame = +3 Query: 765 MGDQDEFRCFIGNLSWSTSDRGLKQAFEKFGHLVEAKVVLDKFSGRSRGFGFVSFEE 935 M ++DE+RCFIGNLSWSTSDRGLK AFEKFGHLV+AKVVLDKFSGRSRGFGFV+F+E Sbjct: 1 MSEEDEYRCFIGNLSWSTSDRGLKDAFEKFGHLVDAKVVLDKFSGRSRGFGFVTFDE 57 >ref|XP_004136860.1| PREDICTED: uncharacterized protein LOC101215898 [Cucumis sativus] gi|449478936|ref|XP_004155458.1| PREDICTED: uncharacterized protein LOC101227324 [Cucumis sativus] Length = 211 Score = 105 bits (262), Expect = 3e-20 Identities = 48/57 (84%), Positives = 54/57 (94%) Frame = +3 Query: 765 MGDQDEFRCFIGNLSWSTSDRGLKQAFEKFGHLVEAKVVLDKFSGRSRGFGFVSFEE 935 M D+ E+RCFIG LSWSTSDRGLK+AFEKFGHLVEAKVV+DKFSGRSRGFGFV+F+E Sbjct: 1 MADEVEYRCFIGGLSWSTSDRGLKEAFEKFGHLVEAKVVVDKFSGRSRGFGFVTFDE 57 >gb|ACX71299.1| RNA-binding protein RZ-1 [Capsicum annuum] Length = 202 Score = 105 bits (261), Expect = 3e-20 Identities = 47/57 (82%), Positives = 55/57 (96%) Frame = +3 Query: 765 MGDQDEFRCFIGNLSWSTSDRGLKQAFEKFGHLVEAKVVLDKFSGRSRGFGFVSFEE 935 M ++DE+RCFIGNLSWSTSDRGLK AFEKFG+LV+AKVVLDKFSGRSRGFGFV+F++ Sbjct: 1 MSEEDEYRCFIGNLSWSTSDRGLKDAFEKFGNLVDAKVVLDKFSGRSRGFGFVTFDD 57 >dbj|BAA12064.1| RNA-binding protein RZ-1 [Nicotiana sylvestris] gi|1435062|dbj|BAA06012.1| RNA binding protein RZ-1 [Nicotiana sylvestris] Length = 209 Score = 102 bits (255), Expect = 2e-19 Identities = 47/53 (88%), Positives = 52/53 (98%) Frame = +3 Query: 777 DEFRCFIGNLSWSTSDRGLKQAFEKFGHLVEAKVVLDKFSGRSRGFGFVSFEE 935 DE+RCFIGNLSWSTSDRGLK AFEKFG+LV+AKVVLDKFSGRSRGFGFV+F+E Sbjct: 4 DEYRCFIGNLSWSTSDRGLKDAFEKFGNLVDAKVVLDKFSGRSRGFGFVTFDE 56 >emb|CBI35498.3| unnamed protein product [Vitis vinifera] Length = 153 Score = 102 bits (255), Expect = 2e-19 Identities = 46/57 (80%), Positives = 53/57 (92%) Frame = +3 Query: 765 MGDQDEFRCFIGNLSWSTSDRGLKQAFEKFGHLVEAKVVLDKFSGRSRGFGFVSFEE 935 M + +E+RCFIG LSWSTSDR LK+AFEKFGHLVEAKVV+DKFSGRSRGFGFVSF++ Sbjct: 1 MSEHEEYRCFIGGLSWSTSDRSLKEAFEKFGHLVEAKVVVDKFSGRSRGFGFVSFDD 57 >ref|XP_002523766.1| dc50, putative [Ricinus communis] gi|223536978|gb|EEF38615.1| dc50, putative [Ricinus communis] Length = 210 Score = 102 bits (255), Expect = 2e-19 Identities = 46/57 (80%), Positives = 54/57 (94%) Frame = +3 Query: 765 MGDQDEFRCFIGNLSWSTSDRGLKQAFEKFGHLVEAKVVLDKFSGRSRGFGFVSFEE 935 M ++ E+RCFIG LSWSTSDRGLK+AFEKFGHL+EAKVV+DKFSGRSRGFGFV+F+E Sbjct: 1 MSEEVEYRCFIGGLSWSTSDRGLKEAFEKFGHLLEAKVVVDKFSGRSRGFGFVTFDE 57 >ref|XP_002264022.1| PREDICTED: uncharacterized protein LOC100256416 isoform 1 [Vitis vinifera] gi|359493015|ref|XP_003634493.1| PREDICTED: uncharacterized protein LOC100256416 isoform 2 [Vitis vinifera] Length = 207 Score = 102 bits (255), Expect = 2e-19 Identities = 46/57 (80%), Positives = 53/57 (92%) Frame = +3 Query: 765 MGDQDEFRCFIGNLSWSTSDRGLKQAFEKFGHLVEAKVVLDKFSGRSRGFGFVSFEE 935 M + +E+RCFIG LSWSTSDR LK+AFEKFGHLVEAKVV+DKFSGRSRGFGFVSF++ Sbjct: 1 MSEHEEYRCFIGGLSWSTSDRSLKEAFEKFGHLVEAKVVVDKFSGRSRGFGFVSFDD 57 >ref|XP_006341831.1| PREDICTED: glycine-rich RNA-binding protein 7-like isoform X1 [Solanum tuberosum] gi|565349710|ref|XP_006341832.1| PREDICTED: glycine-rich RNA-binding protein 7-like isoform X2 [Solanum tuberosum] Length = 214 Score = 102 bits (254), Expect = 2e-19 Identities = 45/57 (78%), Positives = 54/57 (94%) Frame = +3 Query: 765 MGDQDEFRCFIGNLSWSTSDRGLKQAFEKFGHLVEAKVVLDKFSGRSRGFGFVSFEE 935 MG+ DE+RCFIGNLSWSTSDRGLK AF KFG+L++AKVV+DKFSGRS+GFGFV+F+E Sbjct: 1 MGEDDEYRCFIGNLSWSTSDRGLKDAFRKFGNLLDAKVVVDKFSGRSKGFGFVTFDE 57 >ref|XP_002299678.2| hypothetical protein POPTR_0001s21460g [Populus trichocarpa] gi|550347818|gb|EEE84483.2| hypothetical protein POPTR_0001s21460g [Populus trichocarpa] Length = 215 Score = 100 bits (250), Expect = 6e-19 Identities = 45/57 (78%), Positives = 53/57 (92%) Frame = +3 Query: 765 MGDQDEFRCFIGNLSWSTSDRGLKQAFEKFGHLVEAKVVLDKFSGRSRGFGFVSFEE 935 M ++ E+RCFIG LSWSTSDRGLK+ FEKFGHL+EAKVV+DKFSGRSRGFGFV+F+E Sbjct: 1 MSEELEYRCFIGGLSWSTSDRGLKETFEKFGHLLEAKVVVDKFSGRSRGFGFVTFDE 57 >ref|XP_004248805.1| PREDICTED: uncharacterized protein LOC101246099 [Solanum lycopersicum] Length = 214 Score = 100 bits (250), Expect = 6e-19 Identities = 44/57 (77%), Positives = 54/57 (94%) Frame = +3 Query: 765 MGDQDEFRCFIGNLSWSTSDRGLKQAFEKFGHLVEAKVVLDKFSGRSRGFGFVSFEE 935 MG+ DE+RCFIGNLSWSTS+RGLK AF KFG+L++AKVV+DKFSGRS+GFGFV+F+E Sbjct: 1 MGEDDEYRCFIGNLSWSTSERGLKDAFRKFGNLLDAKVVVDKFSGRSKGFGFVTFDE 57 >ref|XP_006291770.1| hypothetical protein CARUB_v10017941mg [Capsella rubella] gi|565467782|ref|XP_006291771.1| hypothetical protein CARUB_v10017941mg [Capsella rubella] gi|482560477|gb|EOA24668.1| hypothetical protein CARUB_v10017941mg [Capsella rubella] gi|482560478|gb|EOA24669.1| hypothetical protein CARUB_v10017941mg [Capsella rubella] Length = 241 Score = 100 bits (249), Expect = 8e-19 Identities = 44/57 (77%), Positives = 52/57 (91%) Frame = +3 Query: 765 MGDQDEFRCFIGNLSWSTSDRGLKQAFEKFGHLVEAKVVLDKFSGRSRGFGFVSFEE 935 M + EFRCFIG L+WSTSDRGL+ AFEK+GHL+EAKVVLDKFSGRSRGFGF++F+E Sbjct: 1 MSEDPEFRCFIGGLAWSTSDRGLRDAFEKYGHLLEAKVVLDKFSGRSRGFGFITFDE 57 >ref|XP_002875318.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297321156|gb|EFH51577.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 247 Score = 100 bits (249), Expect = 8e-19 Identities = 44/57 (77%), Positives = 52/57 (91%) Frame = +3 Query: 765 MGDQDEFRCFIGNLSWSTSDRGLKQAFEKFGHLVEAKVVLDKFSGRSRGFGFVSFEE 935 M + E+RCFIG L+WSTSDRGL+ AFEK+GHLVEAKVVLDKFSGRSRGFGF++F+E Sbjct: 1 MSEDPEYRCFIGGLAWSTSDRGLRDAFEKYGHLVEAKVVLDKFSGRSRGFGFITFDE 57 >ref|XP_006854598.1| hypothetical protein AMTR_s00030p00132070 [Amborella trichopoda] gi|548858284|gb|ERN16065.1| hypothetical protein AMTR_s00030p00132070 [Amborella trichopoda] Length = 223 Score = 99.8 bits (247), Expect = 1e-18 Identities = 43/58 (74%), Positives = 55/58 (94%) Frame = +3 Query: 762 NMGDQDEFRCFIGNLSWSTSDRGLKQAFEKFGHLVEAKVVLDKFSGRSRGFGFVSFEE 935 +MG+ E+RCFIG LSWSTSDRGL++AFEKFGHLV+AKVV+D++SGRSRGFGFV+F++ Sbjct: 51 DMGEAMEYRCFIGGLSWSTSDRGLREAFEKFGHLVDAKVVVDRYSGRSRGFGFVTFDD 108 >ref|XP_007037359.1| RNA-binding family protein with retrovirus zinc finger-like domain isoform 2 [Theobroma cacao] gi|508774604|gb|EOY21860.1| RNA-binding family protein with retrovirus zinc finger-like domain isoform 2 [Theobroma cacao] Length = 215 Score = 99.8 bits (247), Expect = 1e-18 Identities = 45/57 (78%), Positives = 54/57 (94%) Frame = +3 Query: 765 MGDQDEFRCFIGNLSWSTSDRGLKQAFEKFGHLVEAKVVLDKFSGRSRGFGFVSFEE 935 M ++ E+RCFIGNLSWSTSDRGLK AFEKFG+L+EAKVV+DKFSGRSRGFGFV+F++ Sbjct: 1 MPEEVEYRCFIGNLSWSTSDRGLKDAFEKFGNLLEAKVVVDKFSGRSRGFGFVTFDD 57 >ref|XP_007037358.1| RNA-binding family protein with retrovirus zinc finger-like domain isoform 1 [Theobroma cacao] gi|508774603|gb|EOY21859.1| RNA-binding family protein with retrovirus zinc finger-like domain isoform 1 [Theobroma cacao] Length = 208 Score = 99.8 bits (247), Expect = 1e-18 Identities = 45/57 (78%), Positives = 54/57 (94%) Frame = +3 Query: 765 MGDQDEFRCFIGNLSWSTSDRGLKQAFEKFGHLVEAKVVLDKFSGRSRGFGFVSFEE 935 M ++ E+RCFIGNLSWSTSDRGLK AFEKFG+L+EAKVV+DKFSGRSRGFGFV+F++ Sbjct: 1 MPEEVEYRCFIGNLSWSTSDRGLKDAFEKFGNLLEAKVVVDKFSGRSRGFGFVTFDD 57 >ref|NP_189273.1| zinc finger-containing glycine-rich RNA-binding protein [Arabidopsis thaliana] gi|15983477|gb|AAL11606.1|AF424613_1 AT3g26420/F20C19_14 [Arabidopsis thaliana] gi|9294301|dbj|BAB02203.1| unnamed protein product [Arabidopsis thaliana] gi|15451066|gb|AAK96804.1| Unknown protein [Arabidopsis thaliana] gi|18377412|gb|AAL66872.1| unknown protein [Arabidopsis thaliana] gi|62320797|dbj|BAD93728.1| RNA-binding protein [Arabidopsis thaliana] gi|110742443|dbj|BAE99140.1| putative RNA-binding protein [Arabidopsis thaliana] gi|332643635|gb|AEE77156.1| zinc finger-containing glycine-rich RNA-binding protein [Arabidopsis thaliana] Length = 245 Score = 99.4 bits (246), Expect = 2e-18 Identities = 43/57 (75%), Positives = 52/57 (91%) Frame = +3 Query: 765 MGDQDEFRCFIGNLSWSTSDRGLKQAFEKFGHLVEAKVVLDKFSGRSRGFGFVSFEE 935 M + E+RCFIG L+W+TSDRGL+ AFEK+GHLVEAKVVLDKFSGRSRGFGF++F+E Sbjct: 1 MSEDPEYRCFIGGLAWTTSDRGLRDAFEKYGHLVEAKVVLDKFSGRSRGFGFITFDE 57 >ref|XP_004504757.1| PREDICTED: glycine-rich RNA-binding protein-like isoform X1 [Cicer arietinum] Length = 212 Score = 99.4 bits (246), Expect = 2e-18 Identities = 45/60 (75%), Positives = 51/60 (85%) Frame = +3 Query: 756 QLNMGDQDEFRCFIGNLSWSTSDRGLKQAFEKFGHLVEAKVVLDKFSGRSRGFGFVSFEE 935 Q M D+DE+RCFIG L+WSTSDR LK FEKFG L EAKVV+DKFSGRSRGFGFV+F+E Sbjct: 2 QFKMSDEDEYRCFIGGLAWSTSDRKLKDTFEKFGKLTEAKVVVDKFSGRSRGFGFVTFDE 61 >ref|XP_006395557.1| hypothetical protein EUTSA_v10004793mg [Eutrema salsugineum] gi|312283439|dbj|BAJ34585.1| unnamed protein product [Thellungiella halophila] gi|557092196|gb|ESQ32843.1| hypothetical protein EUTSA_v10004793mg [Eutrema salsugineum] Length = 259 Score = 99.4 bits (246), Expect = 2e-18 Identities = 43/57 (75%), Positives = 52/57 (91%) Frame = +3 Query: 765 MGDQDEFRCFIGNLSWSTSDRGLKQAFEKFGHLVEAKVVLDKFSGRSRGFGFVSFEE 935 M + E+RCFIG L+WSTSDRGL+ AFEK+GHL+EAKVVLDKFSGRSRGFGF++F+E Sbjct: 1 MSEDPEYRCFIGGLAWSTSDRGLRDAFEKYGHLLEAKVVLDKFSGRSRGFGFITFDE 57 >gb|AAL09710.1| AT3g26420/F20C19_14 [Arabidopsis thaliana] gi|19699180|gb|AAL90956.1| AT3g26420/F20C19_14 [Arabidopsis thaliana] Length = 148 Score = 99.4 bits (246), Expect = 2e-18 Identities = 43/57 (75%), Positives = 52/57 (91%) Frame = +3 Query: 765 MGDQDEFRCFIGNLSWSTSDRGLKQAFEKFGHLVEAKVVLDKFSGRSRGFGFVSFEE 935 M + E+RCFIG L+W+TSDRGL+ AFEK+GHLVEAKVVLDKFSGRSRGFGF++F+E Sbjct: 1 MSEDPEYRCFIGGLAWTTSDRGLRDAFEKYGHLVEAKVVLDKFSGRSRGFGFITFDE 57