BLASTX nr result
ID: Mentha23_contig00018715
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00018715 (354 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU18157.1| hypothetical protein MIMGU_mgv1a0102811mg, partia... 85 9e-15 gb|ACH54085.1| putative chlorophyll b reductase [Nicotiana tabacum] 60 2e-07 >gb|EYU18157.1| hypothetical protein MIMGU_mgv1a0102811mg, partial [Mimulus guttatus] Length = 146 Score = 85.1 bits (209), Expect = 9e-15 Identities = 47/92 (51%), Positives = 59/92 (64%) Frame = -3 Query: 283 MTTVAKLHLLPLDCHSHTGQPPPSRIILRHRLLWDPVAVKPRRRIYIRPCRSFKSDQEGF 104 MTT+AKL+L PLD H TGQPPP R++ RHR L+DPV K R R I +SF+S + Sbjct: 1 MTTLAKLNLRPLDSHLQTGQPPP-RLLFRHRFLFDPVRAKGRGRFCI---QSFRSKEGSG 56 Query: 103 GFGEREKKCEETCGRVSESSDIGSEKSVNKFV 8 G E+ KK EE G + S+ GS KS+NK V Sbjct: 57 GMEEKNKKIEENRGELMTSNGYGSRKSLNKLV 88 >gb|ACH54085.1| putative chlorophyll b reductase [Nicotiana tabacum] Length = 506 Score = 60.5 bits (145), Expect = 2e-07 Identities = 38/99 (38%), Positives = 54/99 (54%), Gaps = 8/99 (8%) Frame = -3 Query: 283 MTTVAKLHLLPLDCHSH----TGQPPPSRIIL-RHRLLWDPVAVKPRRRIYIRPCRSFKS 119 M VAK+H+ L+CH + +G PP S +L R WDP+ VK RR+I ++PCRSFKS Sbjct: 1 MAMVAKVHVSTLECHHYYHRGSGHPPLSGNVLPRVVTTWDPLIVKGRRKIVVQPCRSFKS 60 Query: 118 DQEGFGFGEREKKCEETCGRVSE---SSDIGSEKSVNKF 11 + E E +K + G + S S ++ NKF Sbjct: 61 EDEYVKGSEIKKPMNKLVGAIRSAVWSCSKPSLRTENKF 99