BLASTX nr result
ID: Mentha23_contig00018582
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00018582 (439 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU43558.1| hypothetical protein MIMGU_mgv1a005603mg [Mimulus... 56 5e-06 >gb|EYU43558.1| hypothetical protein MIMGU_mgv1a005603mg [Mimulus guttatus] Length = 477 Score = 56.2 bits (134), Expect = 5e-06 Identities = 43/113 (38%), Positives = 57/113 (50%), Gaps = 16/113 (14%) Frame = -3 Query: 362 VPKQPLQSK-------------VHV--AALSEVDELEEPKPSRGKVNLSHSNPTMKEDAA 228 +PKQPL + +H +ALSE+D+ EE + K N SH P +++ Sbjct: 248 IPKQPLLQQSTTNRGTASAPEMMHFPSSALSEIDDEEEEEEQEPK-NFSHLEP--EDNLQ 304 Query: 227 LKTSTGQVENKQFVPFLCPPSQSYAPLH-VKENGSHPSATKNINDDADLHDVL 72 K + E KQFVPF+ PS LH VKE HP+ K N+D DL DVL Sbjct: 305 EKKPFHKEEEKQFVPFISSPS-----LHPVKEQNRHPAVLKTRNEDMDLQDVL 352