BLASTX nr result
ID: Mentha23_contig00018553
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00018553 (322 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU39126.1| hypothetical protein MIMGU_mgv1a012968mg [Mimulus... 67 3e-09 gb|EPS71398.1| hypothetical protein M569_03365 [Genlisea aurea] 62 6e-08 gb|EXB55273.1| Polyadenylate-binding protein 2 [Morus notabilis] 60 4e-07 ref|XP_006359788.1| PREDICTED: polyadenylate-binding protein 2-l... 59 7e-07 ref|XP_006597028.1| PREDICTED: uncharacterized protein LOC100791... 59 9e-07 ref|NP_001239931.1| uncharacterized protein LOC100791351 [Glycin... 59 9e-07 ref|NP_001240115.1| uncharacterized protein LOC100784473 [Glycin... 59 9e-07 ref|XP_004248796.1| PREDICTED: polyadenylate-binding protein 2-l... 57 3e-06 ref|XP_007148398.1| hypothetical protein PHAVU_006G205100g [Phas... 57 4e-06 ref|XP_006828070.1| hypothetical protein AMTR_s00008p00267630 [A... 57 4e-06 ref|XP_004168611.1| PREDICTED: polyadenylate-binding protein 2-l... 57 4e-06 ref|XP_004137160.1| PREDICTED: polyadenylate-binding protein 2-l... 57 4e-06 ref|NP_201329.1| RNA recognition motif-containing protein [Arabi... 56 6e-06 gb|ABL97957.1| poly(A)-binding protein II-like [Brassica rapa] 56 6e-06 >gb|EYU39126.1| hypothetical protein MIMGU_mgv1a012968mg [Mimulus guttatus] Length = 234 Score = 67.0 bits (162), Expect = 3e-09 Identities = 28/34 (82%), Positives = 29/34 (85%) Frame = +1 Query: 1 RSRTPFPAAPYIYSPYGYGKAPRFRVPMRYSPYF 102 RSRTPF P +YSPYGYGK PRFRVPMRYSPYF Sbjct: 200 RSRTPFMPVPLVYSPYGYGKVPRFRVPMRYSPYF 233 >gb|EPS71398.1| hypothetical protein M569_03365 [Genlisea aurea] Length = 218 Score = 62.4 bits (150), Expect = 6e-08 Identities = 27/35 (77%), Positives = 30/35 (85%), Gaps = 1/35 (2%) Frame = +1 Query: 1 RSRTPF-PAAPYIYSPYGYGKAPRFRVPMRYSPYF 102 RSR P+ AAP+IY+PYGYGK PRFR PMRYSPYF Sbjct: 184 RSRVPYVAAAPFIYAPYGYGKVPRFRAPMRYSPYF 218 >gb|EXB55273.1| Polyadenylate-binding protein 2 [Morus notabilis] Length = 197 Score = 59.7 bits (143), Expect = 4e-07 Identities = 23/34 (67%), Positives = 28/34 (82%) Frame = +1 Query: 1 RSRTPFPAAPYIYSPYGYGKAPRFRVPMRYSPYF 102 R R+P+ P++YSPYGYGK PR R+PMRYSPYF Sbjct: 164 RGRSPYVPPPFMYSPYGYGKVPRMRMPMRYSPYF 197 >ref|XP_006359788.1| PREDICTED: polyadenylate-binding protein 2-like [Solanum tuberosum] Length = 196 Score = 58.9 bits (141), Expect = 7e-07 Identities = 24/34 (70%), Positives = 26/34 (76%) Frame = +1 Query: 1 RSRTPFPAAPYIYSPYGYGKAPRFRVPMRYSPYF 102 R RTPF APY + P+GYGK PR R PMRYSPYF Sbjct: 163 RGRTPFMPAPYFFPPFGYGKIPRARAPMRYSPYF 196 >ref|XP_006597028.1| PREDICTED: uncharacterized protein LOC100791351 isoform X1 [Glycine max] Length = 125 Score = 58.5 bits (140), Expect = 9e-07 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = +1 Query: 1 RSRTPFPAAPYIYSPYGYGKAPRFRVPMRYSPYF 102 R RTP+ A P+IYSPYGYGK PRFR+ MRYSPY+ Sbjct: 93 RGRTPY-APPFIYSPYGYGKVPRFRMAMRYSPYY 125 >ref|NP_001239931.1| uncharacterized protein LOC100791351 [Glycine max] gi|255647673|gb|ACU24298.1| unknown [Glycine max] Length = 197 Score = 58.5 bits (140), Expect = 9e-07 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = +1 Query: 1 RSRTPFPAAPYIYSPYGYGKAPRFRVPMRYSPYF 102 R RTP+ A P+IYSPYGYGK PRFR+ MRYSPY+ Sbjct: 165 RGRTPY-APPFIYSPYGYGKVPRFRMAMRYSPYY 197 >ref|NP_001240115.1| uncharacterized protein LOC100784473 [Glycine max] gi|255635956|gb|ACU18324.1| unknown [Glycine max] Length = 197 Score = 58.5 bits (140), Expect = 9e-07 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = +1 Query: 1 RSRTPFPAAPYIYSPYGYGKAPRFRVPMRYSPYF 102 R RTP+ AAP+IYSPYGYGK PRFR+ MR+SPY+ Sbjct: 165 RGRTPY-AAPFIYSPYGYGKVPRFRMAMRHSPYY 197 >ref|XP_004248796.1| PREDICTED: polyadenylate-binding protein 2-like [Solanum lycopersicum] Length = 196 Score = 57.0 bits (136), Expect = 3e-06 Identities = 23/34 (67%), Positives = 25/34 (73%) Frame = +1 Query: 1 RSRTPFPAAPYIYSPYGYGKAPRFRVPMRYSPYF 102 R R PF APY + P+GYGK PR R PMRYSPYF Sbjct: 163 RGRAPFMPAPYFFPPFGYGKIPRARAPMRYSPYF 196 >ref|XP_007148398.1| hypothetical protein PHAVU_006G205100g [Phaseolus vulgaris] gi|561021621|gb|ESW20392.1| hypothetical protein PHAVU_006G205100g [Phaseolus vulgaris] Length = 195 Score = 56.6 bits (135), Expect = 4e-06 Identities = 24/34 (70%), Positives = 29/34 (85%) Frame = +1 Query: 1 RSRTPFPAAPYIYSPYGYGKAPRFRVPMRYSPYF 102 R RTP+ A P+IYSPYG+GK PRFR+ MRYSPY+ Sbjct: 163 RGRTPY-APPFIYSPYGHGKVPRFRMAMRYSPYY 195 >ref|XP_006828070.1| hypothetical protein AMTR_s00008p00267630 [Amborella trichopoda] gi|548832705|gb|ERM95486.1| hypothetical protein AMTR_s00008p00267630 [Amborella trichopoda] Length = 220 Score = 56.6 bits (135), Expect = 4e-06 Identities = 25/34 (73%), Positives = 26/34 (76%) Frame = +1 Query: 1 RSRTPFPAAPYIYSPYGYGKAPRFRVPMRYSPYF 102 RSR P+ PY YSPYGYGK PRFR PMRY PYF Sbjct: 188 RSRRPY-MPPYFYSPYGYGKVPRFRRPMRYRPYF 220 >ref|XP_004168611.1| PREDICTED: polyadenylate-binding protein 2-like [Cucumis sativus] Length = 196 Score = 56.6 bits (135), Expect = 4e-06 Identities = 23/34 (67%), Positives = 28/34 (82%) Frame = +1 Query: 1 RSRTPFPAAPYIYSPYGYGKAPRFRVPMRYSPYF 102 RSR+P+ APY +SPYGYGK PRFR+P RY PY+ Sbjct: 164 RSRSPY-VAPYFFSPYGYGKVPRFRMPTRYGPYY 196 >ref|XP_004137160.1| PREDICTED: polyadenylate-binding protein 2-like [Cucumis sativus] Length = 196 Score = 56.6 bits (135), Expect = 4e-06 Identities = 23/34 (67%), Positives = 28/34 (82%) Frame = +1 Query: 1 RSRTPFPAAPYIYSPYGYGKAPRFRVPMRYSPYF 102 RSR+P+ APY +SPYGYGK PRFR+P RY PY+ Sbjct: 164 RSRSPY-VAPYFFSPYGYGKVPRFRMPTRYGPYY 196 >ref|NP_201329.1| RNA recognition motif-containing protein [Arabidopsis thaliana] gi|14423494|gb|AAK62429.1|AF386984_1 poly(A)-binding protein II-like [Arabidopsis thaliana] gi|10178188|dbj|BAB11662.1| poly(A)-binding protein II-like [Arabidopsis thaliana] gi|23197620|gb|AAN15337.1| poly(A)-binding protein II-like [Arabidopsis thaliana] gi|332010647|gb|AED98030.1| RNA recognition motif-containing protein [Arabidopsis thaliana] Length = 220 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/33 (75%), Positives = 27/33 (81%) Frame = +1 Query: 1 RSRTPFPAAPYIYSPYGYGKAPRFRVPMRYSPY 99 R R PF +PY+YSPYGYGKAPRFR PMRY PY Sbjct: 188 RFRRPF-MSPYMYSPYGYGKAPRFRRPMRYMPY 219 >gb|ABL97957.1| poly(A)-binding protein II-like [Brassica rapa] Length = 220 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/33 (75%), Positives = 27/33 (81%) Frame = +1 Query: 1 RSRTPFPAAPYIYSPYGYGKAPRFRVPMRYSPY 99 R R PF +PY+YSPYGYGKAPRFR PMRY PY Sbjct: 188 RFRRPF-MSPYMYSPYGYGKAPRFRRPMRYMPY 219