BLASTX nr result
ID: Mentha23_contig00018465
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00018465 (418 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU30279.1| hypothetical protein MIMGU_mgv1a013333mg [Mimulus... 58 2e-06 >gb|EYU30279.1| hypothetical protein MIMGU_mgv1a013333mg [Mimulus guttatus] Length = 223 Score = 57.8 bits (138), Expect = 2e-06 Identities = 31/62 (50%), Positives = 38/62 (61%) Frame = +3 Query: 3 RESANKFDSRRKXXXXXXXXXXXERRMLPPQTPRYSLRSTSKENKKPPIPMASAMSLEKS 182 RE A K + RRK R +TPRYSLRS+SKEN+KPP+PM S S+E+S Sbjct: 148 REVAGKLEGRRKSVAAAAAATPVAERR-EARTPRYSLRSSSKENRKPPLPMGSMTSVERS 206 Query: 183 VG 188 VG Sbjct: 207 VG 208