BLASTX nr result
ID: Mentha23_contig00018254
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00018254 (367 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU21883.1| hypothetical protein MIMGU_mgv1a005504mg [Mimulus... 68 2e-09 gb|EYU21882.1| hypothetical protein MIMGU_mgv1a005504mg [Mimulus... 68 2e-09 >gb|EYU21883.1| hypothetical protein MIMGU_mgv1a005504mg [Mimulus guttatus] Length = 477 Score = 67.8 bits (164), Expect = 2e-09 Identities = 30/37 (81%), Positives = 35/37 (94%) Frame = +3 Query: 252 MAGNLEKWRAFGPFFTVVWSFSMAAIFVSAERNLKLE 362 MAGNLE+W+AFGPFFTVVWSF +A+IFVSAER+LK E Sbjct: 1 MAGNLERWKAFGPFFTVVWSFLLASIFVSAERSLKKE 37 >gb|EYU21882.1| hypothetical protein MIMGU_mgv1a005504mg [Mimulus guttatus] Length = 481 Score = 67.8 bits (164), Expect = 2e-09 Identities = 30/37 (81%), Positives = 35/37 (94%) Frame = +3 Query: 252 MAGNLEKWRAFGPFFTVVWSFSMAAIFVSAERNLKLE 362 MAGNLE+W+AFGPFFTVVWSF +A+IFVSAER+LK E Sbjct: 1 MAGNLERWKAFGPFFTVVWSFLLASIFVSAERSLKKE 37