BLASTX nr result
ID: Mentha23_contig00017672
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00017672 (416 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006377376.1| hypothetical protein POPTR_0011s05370g [Popu... 65 4e-16 gb|EYU43385.1| hypothetical protein MIMGU_mgv1a009433mg [Mimulus... 73 4e-11 gb|EPS57449.1| hypothetical protein M569_17368, partial [Genlise... 70 4e-10 ref|XP_007211658.1| hypothetical protein PRUPE_ppa008978mg [Prun... 67 2e-09 ref|XP_004134699.1| PREDICTED: 30S ribosomal protein S5, chlorop... 67 2e-09 ref|XP_004294008.1| PREDICTED: 30S ribosomal protein S5, chlorop... 67 3e-09 sp|Q9ST69.1|RR5_SPIOL RecName: Full=30S ribosomal protein S5, ch... 67 3e-09 ref|XP_007159337.1| hypothetical protein PHAVU_002G229700g [Phas... 66 4e-09 gb|AGV54467.1| 30S ribosomal protein S5 [Phaseolus vulgaris] 66 4e-09 ref|XP_006849392.1| hypothetical protein AMTR_s00160p00027870 [A... 66 6e-09 ref|XP_006294552.1| hypothetical protein CARUB_v10023587mg, part... 66 6e-09 ref|XP_004232896.1| PREDICTED: 30S ribosomal protein S5, chlorop... 66 6e-09 ref|XP_002881306.1| ribosomal protein S5 family protein [Arabido... 66 6e-09 ref|XP_002878593.1| hypothetical protein ARALYDRAFT_343774 [Arab... 66 6e-09 ref|XP_002509457.1| 30S ribosomal protein S5, putative [Ricinus ... 66 6e-09 ref|NP_180936.1| 30S ribosomal protein S5 [Arabidopsis thaliana]... 66 6e-09 ref|XP_002305129.1| hypothetical protein POPTR_0004s04550g [Popu... 65 7e-09 ref|XP_006650245.1| PREDICTED: 30S ribosomal protein S5, chlorop... 65 1e-08 ref|NP_001050474.1| Os03g0452300 [Oryza sativa Japonica Group] g... 65 1e-08 ref|XP_003542738.1| PREDICTED: 30S ribosomal protein S5, chlorop... 65 1e-08 >ref|XP_006377376.1| hypothetical protein POPTR_0011s05370g [Populus trichocarpa] gi|550327665|gb|ERP55173.1| hypothetical protein POPTR_0011s05370g [Populus trichocarpa] Length = 294 Score = 65.5 bits (158), Expect(2) = 4e-16 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = +1 Query: 163 NARRNIVAVPMTKYKTFPHRSEADYGAARVMLRPA 267 NARRNI+ VPMTKY TFPHRSE D+GAA+VMLRPA Sbjct: 203 NARRNIITVPMTKYLTFPHRSEGDFGAAKVMLRPA 237 Score = 44.7 bits (104), Expect(2) = 4e-16 Identities = 19/22 (86%), Positives = 21/22 (95%) Frame = +2 Query: 341 QKMRQFSEVAEQRGIPMEELWK 406 QKMRQFS+VA +RGIPMEELWK Sbjct: 273 QKMRQFSDVARERGIPMEELWK 294 >gb|EYU43385.1| hypothetical protein MIMGU_mgv1a009433mg [Mimulus guttatus] Length = 342 Score = 73.2 bits (178), Expect = 4e-11 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = +1 Query: 163 NARRNIVAVPMTKYKTFPHRSEADYGAARVMLRPA 267 NARRNIV+VPMTKYKTFPHRSEADYGAARVMLRPA Sbjct: 241 NARRNIVSVPMTKYKTFPHRSEADYGAARVMLRPA 275 >gb|EPS57449.1| hypothetical protein M569_17368, partial [Genlisea aurea] Length = 216 Score = 69.7 bits (169), Expect = 4e-10 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = +1 Query: 163 NARRNIVAVPMTKYKTFPHRSEADYGAARVMLRPA 267 NARRNI+ VPMTKYKTFPHRSEA+YGAA+VMLRPA Sbjct: 115 NARRNIITVPMTKYKTFPHRSEAEYGAAKVMLRPA 149 >ref|XP_007211658.1| hypothetical protein PRUPE_ppa008978mg [Prunus persica] gi|462407523|gb|EMJ12857.1| hypothetical protein PRUPE_ppa008978mg [Prunus persica] Length = 312 Score = 67.4 bits (163), Expect = 2e-09 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = +1 Query: 163 NARRNIVAVPMTKYKTFPHRSEADYGAARVMLRPA 267 NARRNI++VPMTKY TFPHRSE DYGAA+VMLRPA Sbjct: 211 NARRNIISVPMTKYLTFPHRSEGDYGAAKVMLRPA 245 >ref|XP_004134699.1| PREDICTED: 30S ribosomal protein S5, chloroplastic-like [Cucumis sativus] gi|449479289|ref|XP_004155560.1| PREDICTED: 30S ribosomal protein S5, chloroplastic-like [Cucumis sativus] Length = 307 Score = 67.4 bits (163), Expect = 2e-09 Identities = 31/35 (88%), Positives = 32/35 (91%) Frame = +1 Query: 163 NARRNIVAVPMTKYKTFPHRSEADYGAARVMLRPA 267 NARRNIV VPMTKY TFPHRSE DYGAA+VMLRPA Sbjct: 206 NARRNIVTVPMTKYLTFPHRSEGDYGAAKVMLRPA 240 >ref|XP_004294008.1| PREDICTED: 30S ribosomal protein S5, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 314 Score = 67.0 bits (162), Expect = 3e-09 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = +1 Query: 163 NARRNIVAVPMTKYKTFPHRSEADYGAARVMLRPA 267 NARRNI+ VPMTKY TFPHRSE DYGAA+VMLRPA Sbjct: 213 NARRNIITVPMTKYLTFPHRSEGDYGAAKVMLRPA 247 >sp|Q9ST69.1|RR5_SPIOL RecName: Full=30S ribosomal protein S5, chloroplastic; Flags: Precursor gi|188036206|pdb|3BBN|E Chain E, Homology Model For The Spinach Chloroplast 30s Subunit Fitted To 9.4a Cryo-Em Map Of The 70s Chlororibosome. gi|5725342|emb|CAA63650.1| ribosomal protein S5 [Spinacia oleracea] Length = 308 Score = 66.6 bits (161), Expect = 3e-09 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = +1 Query: 163 NARRNIVAVPMTKYKTFPHRSEADYGAARVMLRPA 267 +ARRNI+ VPMTKY TFPHR+EADYGAARVMLRPA Sbjct: 207 DARRNIITVPMTKYLTFPHRNEADYGAARVMLRPA 241 >ref|XP_007159337.1| hypothetical protein PHAVU_002G229700g [Phaseolus vulgaris] gi|561032752|gb|ESW31331.1| hypothetical protein PHAVU_002G229700g [Phaseolus vulgaris] Length = 301 Score = 66.2 bits (160), Expect = 4e-09 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = +1 Query: 163 NARRNIVAVPMTKYKTFPHRSEADYGAARVMLRPA 267 NARRNI+ VPMTKY TFPHRS+ DYGAA+VMLRPA Sbjct: 200 NARRNIIKVPMTKYSTFPHRSDGDYGAAKVMLRPA 234 >gb|AGV54467.1| 30S ribosomal protein S5 [Phaseolus vulgaris] Length = 301 Score = 66.2 bits (160), Expect = 4e-09 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = +1 Query: 163 NARRNIVAVPMTKYKTFPHRSEADYGAARVMLRPA 267 NARRNI+ VPMTKY TFPHRS+ DYGAA+VMLRPA Sbjct: 200 NARRNIIKVPMTKYSTFPHRSDGDYGAAKVMLRPA 234 >ref|XP_006849392.1| hypothetical protein AMTR_s00160p00027870 [Amborella trichopoda] gi|548852953|gb|ERN10973.1| hypothetical protein AMTR_s00160p00027870 [Amborella trichopoda] Length = 306 Score = 65.9 bits (159), Expect = 6e-09 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = +1 Query: 163 NARRNIVAVPMTKYKTFPHRSEADYGAARVMLRPA 267 NARRNIV VPMTKY TFPHR++ DYGAA+VMLRPA Sbjct: 205 NARRNIVTVPMTKYSTFPHRADGDYGAAKVMLRPA 239 >ref|XP_006294552.1| hypothetical protein CARUB_v10023587mg, partial [Capsella rubella] gi|482563260|gb|EOA27450.1| hypothetical protein CARUB_v10023587mg, partial [Capsella rubella] Length = 335 Score = 65.9 bits (159), Expect = 6e-09 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = +1 Query: 163 NARRNIVAVPMTKYKTFPHRSEADYGAARVMLRPA 267 +ARRNIV VPMTKY TFPHRSE DYGAA+VMLRPA Sbjct: 234 DARRNIVQVPMTKYSTFPHRSEGDYGAAKVMLRPA 268 >ref|XP_004232896.1| PREDICTED: 30S ribosomal protein S5, chloroplastic-like [Solanum lycopersicum] Length = 305 Score = 65.9 bits (159), Expect = 6e-09 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = +1 Query: 163 NARRNIVAVPMTKYKTFPHRSEADYGAARVMLRPA 267 NARRN++ VPMTKY TFPHRSE D+GAARVMLRPA Sbjct: 204 NARRNLITVPMTKYLTFPHRSEGDFGAARVMLRPA 238 >ref|XP_002881306.1| ribosomal protein S5 family protein [Arabidopsis lyrata subsp. lyrata] gi|297327145|gb|EFH57565.1| ribosomal protein S5 family protein [Arabidopsis lyrata subsp. lyrata] Length = 304 Score = 65.9 bits (159), Expect = 6e-09 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = +1 Query: 163 NARRNIVAVPMTKYKTFPHRSEADYGAARVMLRPA 267 +ARRNIV VPMTKY TFPHRSE DYGAA+VMLRPA Sbjct: 203 DARRNIVQVPMTKYSTFPHRSEGDYGAAKVMLRPA 237 >ref|XP_002878593.1| hypothetical protein ARALYDRAFT_343774 [Arabidopsis lyrata subsp. lyrata] gi|297324432|gb|EFH54852.1| hypothetical protein ARALYDRAFT_343774 [Arabidopsis lyrata subsp. lyrata] Length = 224 Score = 65.9 bits (159), Expect = 6e-09 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = +1 Query: 163 NARRNIVAVPMTKYKTFPHRSEADYGAARVMLRPA 267 +ARRNIV VPMTKY TFPHRSE DYGAA+VMLRPA Sbjct: 127 DARRNIVQVPMTKYSTFPHRSEGDYGAAKVMLRPA 161 >ref|XP_002509457.1| 30S ribosomal protein S5, putative [Ricinus communis] gi|223549356|gb|EEF50844.1| 30S ribosomal protein S5, putative [Ricinus communis] Length = 309 Score = 65.9 bits (159), Expect = 6e-09 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = +1 Query: 163 NARRNIVAVPMTKYKTFPHRSEADYGAARVMLRPA 267 NARRNI+ VPMTKY TFPHRS+ DYGAA+VMLRPA Sbjct: 208 NARRNIITVPMTKYLTFPHRSDGDYGAAKVMLRPA 242 >ref|NP_180936.1| 30S ribosomal protein S5 [Arabidopsis thaliana] gi|75101015|sp|P93014.1|RR5_ARATH RecName: Full=30S ribosomal protein S5, chloroplastic; Flags: Precursor gi|1707008|gb|AAC69132.1| 30S ribosomal protein S5 [Arabidopsis thaliana] gi|15450886|gb|AAK96714.1| 30S ribosomal protein S5 [Arabidopsis thaliana] gi|20259882|gb|AAM13288.1| 30S ribosomal protein S5 [Arabidopsis thaliana] gi|21593322|gb|AAM65271.1| 30S ribosomal protein S5 [Arabidopsis thaliana] gi|330253794|gb|AEC08888.1| 30S ribosomal protein S5 [Arabidopsis thaliana] Length = 303 Score = 65.9 bits (159), Expect = 6e-09 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = +1 Query: 163 NARRNIVAVPMTKYKTFPHRSEADYGAARVMLRPA 267 +ARRNIV VPMTKY TFPHRSE DYGAA+VMLRPA Sbjct: 202 DARRNIVQVPMTKYSTFPHRSEGDYGAAKVMLRPA 236 >ref|XP_002305129.1| hypothetical protein POPTR_0004s04550g [Populus trichocarpa] gi|118487850|gb|ABK95748.1| unknown [Populus trichocarpa] gi|222848093|gb|EEE85640.1| hypothetical protein POPTR_0004s04550g [Populus trichocarpa] Length = 311 Score = 65.5 bits (158), Expect = 7e-09 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = +1 Query: 163 NARRNIVAVPMTKYKTFPHRSEADYGAARVMLRPA 267 NARRNI+ VPMTKY TFPHRSE D+GAA+VMLRPA Sbjct: 210 NARRNIITVPMTKYLTFPHRSEGDFGAAKVMLRPA 244 >ref|XP_006650245.1| PREDICTED: 30S ribosomal protein S5, chloroplastic-like [Oryza brachyantha] Length = 329 Score = 65.1 bits (157), Expect = 1e-08 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = +1 Query: 163 NARRNIVAVPMTKYKTFPHRSEADYGAARVMLRPA 267 N RRN+V VP+TKY TFPHR++ADYGAARVMLRPA Sbjct: 228 NGRRNLVTVPLTKYSTFPHRADADYGAARVMLRPA 262 >ref|NP_001050474.1| Os03g0452300 [Oryza sativa Japonica Group] gi|28209467|gb|AAO37485.1| putative ribosomal protein [Oryza sativa Japonica Group] gi|108709198|gb|ABF96993.1| ribosomal protein S5 containing protein, expressed [Oryza sativa Japonica Group] gi|113548945|dbj|BAF12388.1| Os03g0452300 [Oryza sativa Japonica Group] gi|215686362|dbj|BAG87623.1| unnamed protein product [Oryza sativa Japonica Group] gi|215686840|dbj|BAG89690.1| unnamed protein product [Oryza sativa Japonica Group] gi|215767336|dbj|BAG99564.1| unnamed protein product [Oryza sativa Japonica Group] gi|222625206|gb|EEE59338.1| hypothetical protein OsJ_11420 [Oryza sativa Japonica Group] Length = 326 Score = 65.1 bits (157), Expect = 1e-08 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = +1 Query: 163 NARRNIVAVPMTKYKTFPHRSEADYGAARVMLRPA 267 N RRN+V VP+TKY TFPHR++ADYGAARVMLRPA Sbjct: 225 NGRRNLVTVPLTKYSTFPHRADADYGAARVMLRPA 259 >ref|XP_003542738.1| PREDICTED: 30S ribosomal protein S5, chloroplastic-like [Glycine max] Length = 316 Score = 65.1 bits (157), Expect = 1e-08 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = +1 Query: 163 NARRNIVAVPMTKYKTFPHRSEADYGAARVMLRPA 267 NARRNI+ VPMTKY TFPHR++ DYGAA+VMLRPA Sbjct: 215 NARRNIIKVPMTKYSTFPHRADGDYGAAKVMLRPA 249