BLASTX nr result
ID: Mentha23_contig00017624
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00017624 (365 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU34072.1| hypothetical protein MIMGU_mgv11b0139212mg, parti... 56 6e-06 >gb|EYU34072.1| hypothetical protein MIMGU_mgv11b0139212mg, partial [Mimulus guttatus] Length = 56 Score = 55.8 bits (133), Expect = 6e-06 Identities = 31/39 (79%), Positives = 32/39 (82%), Gaps = 3/39 (7%) Frame = -1 Query: 161 MDLGNST--VKTPEPESETPTRIQPT-KASAFTNGVLKR 54 MDLGNST VKTPE E+ETPTRIQP KA FTNGVLKR Sbjct: 1 MDLGNSTTTVKTPEAETETPTRIQPVLKAPPFTNGVLKR 39