BLASTX nr result
ID: Mentha23_contig00017381
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00017381 (362 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS63301.1| hypothetical protein M569_11486, partial [Genlise... 83 5e-14 gb|EYU28483.1| hypothetical protein MIMGU_mgv1a012151mg [Mimulus... 82 1e-13 ref|XP_006601815.1| PREDICTED: uncharacterized protein LOC100797... 81 2e-13 ref|XP_006487561.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 81 2e-13 ref|XP_006420812.1| hypothetical protein CICLE_v10005642mg [Citr... 81 2e-13 ref|XP_006420808.1| hypothetical protein CICLE_v10005642mg [Citr... 81 2e-13 ref|XP_007043768.1| FKBP-like peptidyl-prolyl cis-trans isomeras... 81 2e-13 ref|XP_007043767.1| FKBP-like peptidyl-prolyl cis-trans isomeras... 81 2e-13 ref|XP_004152320.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 81 2e-13 ref|NP_001241480.1| uncharacterized protein LOC100797411 [Glycin... 81 2e-13 ref|XP_002267989.1| PREDICTED: probable FKBP-type peptidyl-proly... 81 2e-13 ref|XP_006343509.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 80 2e-13 ref|XP_004253232.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 80 2e-13 ref|XP_004975178.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 80 3e-13 ref|XP_004491988.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 80 3e-13 ref|XP_007226020.1| hypothetical protein PRUPE_ppa010126mg [Prun... 80 3e-13 tpg|DAA48874.1| TPA: putative FKBP-like peptidyl-prolyl cis-tran... 80 3e-13 tpg|DAA48872.1| TPA: putative FKBP-like peptidyl-prolyl cis-tran... 80 3e-13 ref|NP_001140628.1| uncharacterized protein LOC100272703 [Zea ma... 80 3e-13 gb|ACF82466.1| unknown [Zea mays] gi|195641426|gb|ACG40181.1| FK... 80 3e-13 >gb|EPS63301.1| hypothetical protein M569_11486, partial [Genlisea aurea] Length = 196 Score = 82.8 bits (203), Expect = 5e-14 Identities = 40/42 (95%), Positives = 41/42 (97%) Frame = -1 Query: 362 KGPRPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKIIPNRS 237 KGPRPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKI+PN S Sbjct: 154 KGPRPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKILPNGS 195 >gb|EYU28483.1| hypothetical protein MIMGU_mgv1a012151mg [Mimulus guttatus] Length = 260 Score = 81.6 bits (200), Expect = 1e-13 Identities = 38/40 (95%), Positives = 40/40 (100%) Frame = -1 Query: 362 KGPRPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKIIPN 243 KGPRPTTFSGQRALDFVLRNQGLIDKTLLFDIEL+KI+PN Sbjct: 218 KGPRPTTFSGQRALDFVLRNQGLIDKTLLFDIELIKIVPN 257 >ref|XP_006601815.1| PREDICTED: uncharacterized protein LOC100797411 isoform X1 [Glycine max] Length = 242 Score = 80.9 bits (198), Expect = 2e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -1 Query: 359 GPRPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKIIPN 243 GPRPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKIIPN Sbjct: 204 GPRPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKIIPN 242 >ref|XP_006487561.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP19, chloroplastic-like isoform X1 [Citrus sinensis] Length = 267 Score = 80.9 bits (198), Expect = 2e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -1 Query: 359 GPRPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKIIPN 243 GPRPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKIIPN Sbjct: 229 GPRPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKIIPN 267 >ref|XP_006420812.1| hypothetical protein CICLE_v10005642mg [Citrus clementina] gi|557522685|gb|ESR34052.1| hypothetical protein CICLE_v10005642mg [Citrus clementina] Length = 250 Score = 80.9 bits (198), Expect = 2e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -1 Query: 359 GPRPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKIIPN 243 GPRPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKIIPN Sbjct: 212 GPRPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKIIPN 250 >ref|XP_006420808.1| hypothetical protein CICLE_v10005642mg [Citrus clementina] gi|567855379|ref|XP_006420809.1| hypothetical protein CICLE_v10005642mg [Citrus clementina] gi|557522681|gb|ESR34048.1| hypothetical protein CICLE_v10005642mg [Citrus clementina] gi|557522682|gb|ESR34049.1| hypothetical protein CICLE_v10005642mg [Citrus clementina] Length = 267 Score = 80.9 bits (198), Expect = 2e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -1 Query: 359 GPRPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKIIPN 243 GPRPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKIIPN Sbjct: 229 GPRPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKIIPN 267 >ref|XP_007043768.1| FKBP-like peptidyl-prolyl cis-trans isomerase family protein isoform 2 [Theobroma cacao] gi|508707703|gb|EOX99599.1| FKBP-like peptidyl-prolyl cis-trans isomerase family protein isoform 2 [Theobroma cacao] Length = 255 Score = 80.9 bits (198), Expect = 2e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -1 Query: 359 GPRPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKIIPN 243 GPRPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKIIPN Sbjct: 217 GPRPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKIIPN 255 >ref|XP_007043767.1| FKBP-like peptidyl-prolyl cis-trans isomerase family protein isoform 1 [Theobroma cacao] gi|508707702|gb|EOX99598.1| FKBP-like peptidyl-prolyl cis-trans isomerase family protein isoform 1 [Theobroma cacao] Length = 249 Score = 80.9 bits (198), Expect = 2e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -1 Query: 359 GPRPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKIIPN 243 GPRPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKIIPN Sbjct: 211 GPRPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKIIPN 249 >ref|XP_004152320.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP19, chloroplastic-like [Cucumis sativus] gi|449522654|ref|XP_004168341.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP19, chloroplastic-like [Cucumis sativus] Length = 257 Score = 80.9 bits (198), Expect = 2e-13 Identities = 40/42 (95%), Positives = 40/42 (95%) Frame = -1 Query: 362 KGPRPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKIIPNRS 237 KGPRPTTFSGQRAL FVLRNQGLIDKTLLFDIELLKIIPN S Sbjct: 215 KGPRPTTFSGQRALAFVLRNQGLIDKTLLFDIELLKIIPNSS 256 >ref|NP_001241480.1| uncharacterized protein LOC100797411 [Glycine max] gi|255646496|gb|ACU23726.1| unknown [Glycine max] Length = 241 Score = 80.9 bits (198), Expect = 2e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -1 Query: 359 GPRPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKIIPN 243 GPRPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKIIPN Sbjct: 203 GPRPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKIIPN 241 >ref|XP_002267989.1| PREDICTED: probable FKBP-type peptidyl-prolyl cis-trans isomerase 7, chloroplastic isoform 1 [Vitis vinifera] gi|296085536|emb|CBI29268.3| unnamed protein product [Vitis vinifera] Length = 257 Score = 80.9 bits (198), Expect = 2e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -1 Query: 359 GPRPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKIIPN 243 GPRPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKIIPN Sbjct: 219 GPRPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKIIPN 257 >ref|XP_006343509.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP19, chloroplastic-like [Solanum tuberosum] Length = 335 Score = 80.5 bits (197), Expect = 2e-13 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -1 Query: 362 KGPRPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKIIPN 243 KGPRPTTFSGQRAL FVLRNQGLIDKTLLFDIELLKIIPN Sbjct: 296 KGPRPTTFSGQRALSFVLRNQGLIDKTLLFDIELLKIIPN 335 >ref|XP_004253232.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP19, chloroplastic-like [Solanum lycopersicum] Length = 247 Score = 80.5 bits (197), Expect = 2e-13 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -1 Query: 362 KGPRPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKIIPN 243 KGPRPTTFSGQRAL FVLRNQGLIDKTLLFDIELLKIIPN Sbjct: 208 KGPRPTTFSGQRALSFVLRNQGLIDKTLLFDIELLKIIPN 247 >ref|XP_004975178.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP19, chloroplastic-like [Setaria italica] Length = 214 Score = 80.1 bits (196), Expect = 3e-13 Identities = 38/40 (95%), Positives = 40/40 (100%) Frame = -1 Query: 359 GPRPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKIIPNR 240 GP+PTTFSGQRALDFVLRNQGLIDKTLLFDIELLKIIPN+ Sbjct: 175 GPKPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKIIPNQ 214 >ref|XP_004491988.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP19, chloroplastic-like [Cicer arietinum] Length = 240 Score = 80.1 bits (196), Expect = 3e-13 Identities = 38/39 (97%), Positives = 39/39 (100%) Frame = -1 Query: 359 GPRPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKIIPN 243 GPRPTTFSGQRALDFVLRNQGLIDKTLLFDIEL+KIIPN Sbjct: 202 GPRPTTFSGQRALDFVLRNQGLIDKTLLFDIELMKIIPN 240 >ref|XP_007226020.1| hypothetical protein PRUPE_ppa010126mg [Prunus persica] gi|462422956|gb|EMJ27219.1| hypothetical protein PRUPE_ppa010126mg [Prunus persica] Length = 262 Score = 80.1 bits (196), Expect = 3e-13 Identities = 38/39 (97%), Positives = 39/39 (100%) Frame = -1 Query: 359 GPRPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKIIPN 243 GPRPTTFSGQRALDFVLRNQGLIDKTLLFDIEL+KIIPN Sbjct: 224 GPRPTTFSGQRALDFVLRNQGLIDKTLLFDIELIKIIPN 262 >tpg|DAA48874.1| TPA: putative FKBP-like peptidyl-prolyl cis-trans isomerase family protein [Zea mays] Length = 198 Score = 80.1 bits (196), Expect = 3e-13 Identities = 38/40 (95%), Positives = 40/40 (100%) Frame = -1 Query: 359 GPRPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKIIPNR 240 GP+PTTFSGQRALDFVLRNQGLIDKTLLFDIELLKIIPN+ Sbjct: 159 GPKPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKIIPNQ 198 >tpg|DAA48872.1| TPA: putative FKBP-like peptidyl-prolyl cis-trans isomerase family protein isoform 1 [Zea mays] gi|414870316|tpg|DAA48873.1| TPA: putative FKBP-like peptidyl-prolyl cis-trans isomerase family protein isoform 2 [Zea mays] Length = 214 Score = 80.1 bits (196), Expect = 3e-13 Identities = 38/40 (95%), Positives = 40/40 (100%) Frame = -1 Query: 359 GPRPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKIIPNR 240 GP+PTTFSGQRALDFVLRNQGLIDKTLLFDIELLKIIPN+ Sbjct: 175 GPKPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKIIPNQ 214 >ref|NP_001140628.1| uncharacterized protein LOC100272703 [Zea mays] gi|194700240|gb|ACF84204.1| unknown [Zea mays] gi|414870311|tpg|DAA48868.1| TPA: putative FKBP-like peptidyl-prolyl cis-trans isomerase family protein [Zea mays] gi|414870312|tpg|DAA48869.1| TPA: putative FKBP-like peptidyl-prolyl cis-trans isomerase family protein [Zea mays] Length = 240 Score = 80.1 bits (196), Expect = 3e-13 Identities = 38/40 (95%), Positives = 40/40 (100%) Frame = -1 Query: 359 GPRPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKIIPNR 240 GP+PTTFSGQRALDFVLRNQGLIDKTLLFDIELLKIIPN+ Sbjct: 201 GPKPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKIIPNQ 240 >gb|ACF82466.1| unknown [Zea mays] gi|195641426|gb|ACG40181.1| FK506 binding protein [Zea mays] gi|414870313|tpg|DAA48870.1| TPA: putative FKBP-like peptidyl-prolyl cis-trans isomerase family protein [Zea mays] gi|414870314|tpg|DAA48871.1| TPA: putative FKBP-like peptidyl-prolyl cis-trans isomerase family protein [Zea mays] Length = 232 Score = 80.1 bits (196), Expect = 3e-13 Identities = 38/40 (95%), Positives = 40/40 (100%) Frame = -1 Query: 359 GPRPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKIIPNR 240 GP+PTTFSGQRALDFVLRNQGLIDKTLLFDIELLKIIPN+ Sbjct: 193 GPKPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKIIPNQ 232