BLASTX nr result
ID: Mentha23_contig00017321
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00017321 (303 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU42818.1| hypothetical protein MIMGU_mgv1a009983mg [Mimulus... 77 3e-12 >gb|EYU42818.1| hypothetical protein MIMGU_mgv1a009983mg [Mimulus guttatus] Length = 325 Score = 76.6 bits (187), Expect = 3e-12 Identities = 45/98 (45%), Positives = 57/98 (58%), Gaps = 2/98 (2%) Frame = -2 Query: 290 AEHVKEEEDAGEAHGSNRDLQIQNEQKDNKHAFP-DQEVRSVLAATREAPVASKEGAFHR 114 AE KEEE+A + SN + QIQNE D+EV S+ E P SKE + H Sbjct: 196 AELEKEEEEAAKGDVSNENEQIQNEPNSTSGQITTDEEVGSLSVEASEMPAVSKEVSSHG 255 Query: 113 AYPARNNVVANKDFEQPQEEK-ITSPPPASNTAFTGSI 3 YPA NN + N EQP+E+K + +PP A+ TAFTGSI Sbjct: 256 DYPALNNSMMNTSLEQPREKKEVQAPPTANKTAFTGSI 293