BLASTX nr result
ID: Mentha23_contig00017252
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00017252 (315 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU22855.1| hypothetical protein MIMGU_mgv1a010065mg [Mimulus... 57 3e-06 >gb|EYU22855.1| hypothetical protein MIMGU_mgv1a010065mg [Mimulus guttatus] Length = 323 Score = 56.6 bits (135), Expect = 3e-06 Identities = 41/93 (44%), Positives = 49/93 (52%), Gaps = 1/93 (1%) Frame = -2 Query: 278 NEASPFCLSRKPTK-KFRIPELSLPVLGKESRSSSPLTLRKIEDVSRKLLSVEENREVGP 102 NE S SRKPTK KF +P SL VL K++ S S TL ++E+ S K+ SV E G Sbjct: 36 NEKSLLFFSRKPTKLKFTVPRFSLQVLKKKNESCSSSTLTEVEEASWKV-SVGEGVRKGT 94 Query: 101 XXXXXXXXXXXXXXXXXVQVAQASENVRANAVY 3 VQ AQASE VRANA+Y Sbjct: 95 PLFVSTVLCSSLAWLTPVQTAQASEYVRANAMY 127