BLASTX nr result
ID: Mentha23_contig00017249
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00017249 (357 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU40473.1| hypothetical protein MIMGU_mgv1a004204mg [Mimulus... 92 1e-16 gb|EYU38030.1| hypothetical protein MIMGU_mgv1a004076mg [Mimulus... 90 4e-16 gb|EXC31549.1| hypothetical protein L484_006581 [Morus notabilis] 90 4e-16 ref|XP_007199777.1| hypothetical protein PRUPE_ppa003711mg [Prun... 90 4e-16 ref|XP_004144885.1| PREDICTED: ubiquilin-2-like isoform 2 [Cucum... 88 1e-15 ref|XP_004144884.1| PREDICTED: ubiquilin-2-like isoform 1 [Cucum... 88 1e-15 ref|XP_007041622.1| Ubiquitin family protein isoform 3 [Theobrom... 88 1e-15 ref|XP_007041621.1| Ubiquitin family protein isoform 2 [Theobrom... 88 1e-15 ref|XP_007041620.1| Ubiquitin family protein isoform 1 [Theobrom... 88 1e-15 gb|AEA50963.1| putative PDF1-interacting protein 1, partial [Gos... 88 1e-15 emb|CAN59899.1| hypothetical protein VITISV_002886 [Vitis vinifera] 87 2e-15 ref|XP_002282473.2| PREDICTED: ubiquilin-1-like [Vitis vinifera] 87 2e-15 emb|CBI37753.3| unnamed protein product [Vitis vinifera] 87 2e-15 ref|XP_006379369.1| hypothetical protein POPTR_0009s16750g [Popu... 86 5e-15 ref|XP_006379368.1| hypothetical protein POPTR_0009s16750g [Popu... 86 5e-15 gb|EPS67253.1| hypothetical protein M569_07523, partial [Genlise... 86 5e-15 gb|EPS65900.1| hypothetical protein M569_08869, partial [Genlise... 86 7e-15 ref|XP_002263194.2| PREDICTED: uncharacterized protein LOC100250... 86 7e-15 emb|CBI38417.3| unnamed protein product [Vitis vinifera] 86 7e-15 ref|XP_006412123.1| hypothetical protein EUTSA_v10024813mg [Eutr... 84 2e-14 >gb|EYU40473.1| hypothetical protein MIMGU_mgv1a004204mg [Mimulus guttatus] Length = 539 Score = 91.7 bits (226), Expect = 1e-16 Identities = 45/50 (90%), Positives = 45/50 (90%) Frame = +3 Query: 207 VNIRCSNGSKFQVKTSLESTVVDFKGLLAQNCDVPAEQQRLIYKGRILKD 356 VNIRCSNGSKF V TSLE TV DFKGLLAQNCDV AEQQRLIYKGRILKD Sbjct: 19 VNIRCSNGSKFSVNTSLELTVADFKGLLAQNCDVTAEQQRLIYKGRILKD 68 >gb|EYU38030.1| hypothetical protein MIMGU_mgv1a004076mg [Mimulus guttatus] Length = 545 Score = 89.7 bits (221), Expect = 4e-16 Identities = 43/50 (86%), Positives = 46/50 (92%) Frame = +3 Query: 207 VNIRCSNGSKFQVKTSLESTVVDFKGLLAQNCDVPAEQQRLIYKGRILKD 356 VNIRCSNGSKF VKT L+STV +FKG+LAQNCDVPAE QRLIYKGRILKD Sbjct: 19 VNIRCSNGSKFSVKTILDSTVGEFKGVLAQNCDVPAEHQRLIYKGRILKD 68 >gb|EXC31549.1| hypothetical protein L484_006581 [Morus notabilis] Length = 553 Score = 89.7 bits (221), Expect = 4e-16 Identities = 43/50 (86%), Positives = 46/50 (92%) Frame = +3 Query: 207 VNIRCSNGSKFQVKTSLESTVVDFKGLLAQNCDVPAEQQRLIYKGRILKD 356 VN+RCSNGSKF V+TSLESTV FK LLAQNCDVPA+QQRLIYKGRILKD Sbjct: 22 VNVRCSNGSKFTVRTSLESTVEAFKALLAQNCDVPADQQRLIYKGRILKD 71 >ref|XP_007199777.1| hypothetical protein PRUPE_ppa003711mg [Prunus persica] gi|462395177|gb|EMJ00976.1| hypothetical protein PRUPE_ppa003711mg [Prunus persica] Length = 555 Score = 89.7 bits (221), Expect = 4e-16 Identities = 41/50 (82%), Positives = 46/50 (92%) Frame = +3 Query: 207 VNIRCSNGSKFQVKTSLESTVVDFKGLLAQNCDVPAEQQRLIYKGRILKD 356 +NIRCSNGSKF V+ SL+STV DFK +LAQNCD+PAEQQRLIYKGRILKD Sbjct: 20 INIRCSNGSKFSVRASLDSTVGDFKAILAQNCDIPAEQQRLIYKGRILKD 69 >ref|XP_004144885.1| PREDICTED: ubiquilin-2-like isoform 2 [Cucumis sativus] gi|449473220|ref|XP_004153821.1| PREDICTED: ubiquilin-2-like isoform 2 [Cucumis sativus] Length = 546 Score = 88.2 bits (217), Expect = 1e-15 Identities = 41/50 (82%), Positives = 45/50 (90%) Frame = +3 Query: 207 VNIRCSNGSKFQVKTSLESTVVDFKGLLAQNCDVPAEQQRLIYKGRILKD 356 VNIRCSNGSKF V TSL+STV FK +LAQNCD+PA+QQRLIYKGRILKD Sbjct: 25 VNIRCSNGSKFSVTTSLDSTVATFKSILAQNCDIPADQQRLIYKGRILKD 74 >ref|XP_004144884.1| PREDICTED: ubiquilin-2-like isoform 1 [Cucumis sativus] gi|449473217|ref|XP_004153820.1| PREDICTED: ubiquilin-2-like isoform 1 [Cucumis sativus] Length = 551 Score = 88.2 bits (217), Expect = 1e-15 Identities = 41/50 (82%), Positives = 45/50 (90%) Frame = +3 Query: 207 VNIRCSNGSKFQVKTSLESTVVDFKGLLAQNCDVPAEQQRLIYKGRILKD 356 VNIRCSNGSKF V TSL+STV FK +LAQNCD+PA+QQRLIYKGRILKD Sbjct: 25 VNIRCSNGSKFSVTTSLDSTVATFKSILAQNCDIPADQQRLIYKGRILKD 74 >ref|XP_007041622.1| Ubiquitin family protein isoform 3 [Theobroma cacao] gi|508705557|gb|EOX97453.1| Ubiquitin family protein isoform 3 [Theobroma cacao] Length = 467 Score = 87.8 bits (216), Expect = 1e-15 Identities = 40/50 (80%), Positives = 46/50 (92%) Frame = +3 Query: 207 VNIRCSNGSKFQVKTSLESTVVDFKGLLAQNCDVPAEQQRLIYKGRILKD 356 VNIRCSNG+KF V+TSL+STV FK +LAQNCD+PA+QQRLIYKGRILKD Sbjct: 25 VNIRCSNGTKFTVRTSLDSTVASFKAVLAQNCDIPADQQRLIYKGRILKD 74 >ref|XP_007041621.1| Ubiquitin family protein isoform 2 [Theobroma cacao] gi|508705556|gb|EOX97452.1| Ubiquitin family protein isoform 2 [Theobroma cacao] Length = 454 Score = 87.8 bits (216), Expect = 1e-15 Identities = 40/50 (80%), Positives = 46/50 (92%) Frame = +3 Query: 207 VNIRCSNGSKFQVKTSLESTVVDFKGLLAQNCDVPAEQQRLIYKGRILKD 356 VNIRCSNG+KF V+TSL+STV FK +LAQNCD+PA+QQRLIYKGRILKD Sbjct: 25 VNIRCSNGTKFTVRTSLDSTVASFKAVLAQNCDIPADQQRLIYKGRILKD 74 >ref|XP_007041620.1| Ubiquitin family protein isoform 1 [Theobroma cacao] gi|508705555|gb|EOX97451.1| Ubiquitin family protein isoform 1 [Theobroma cacao] Length = 624 Score = 87.8 bits (216), Expect = 1e-15 Identities = 40/50 (80%), Positives = 46/50 (92%) Frame = +3 Query: 207 VNIRCSNGSKFQVKTSLESTVVDFKGLLAQNCDVPAEQQRLIYKGRILKD 356 VNIRCSNG+KF V+TSL+STV FK +LAQNCD+PA+QQRLIYKGRILKD Sbjct: 25 VNIRCSNGTKFTVRTSLDSTVASFKAVLAQNCDIPADQQRLIYKGRILKD 74 >gb|AEA50963.1| putative PDF1-interacting protein 1, partial [Gossypium barbadense] Length = 550 Score = 87.8 bits (216), Expect = 1e-15 Identities = 42/50 (84%), Positives = 46/50 (92%) Frame = +3 Query: 207 VNIRCSNGSKFQVKTSLESTVVDFKGLLAQNCDVPAEQQRLIYKGRILKD 356 VNIRCSNG+KF V+TSLESTV FK LLAQNCDVPA+QQRLIYKGR+LKD Sbjct: 22 VNIRCSNGTKFTVRTSLESTVGVFKSLLAQNCDVPADQQRLIYKGRVLKD 71 >emb|CAN59899.1| hypothetical protein VITISV_002886 [Vitis vinifera] Length = 566 Score = 87.4 bits (215), Expect = 2e-15 Identities = 42/50 (84%), Positives = 45/50 (90%) Frame = +3 Query: 207 VNIRCSNGSKFQVKTSLESTVVDFKGLLAQNCDVPAEQQRLIYKGRILKD 356 VNIRCSNGSKF V+T LESTV FK LLAQNCDVP++QQRLIYKGRILKD Sbjct: 19 VNIRCSNGSKFSVRTCLESTVGXFKALLAQNCDVPSDQQRLIYKGRILKD 68 >ref|XP_002282473.2| PREDICTED: ubiquilin-1-like [Vitis vinifera] Length = 558 Score = 87.0 bits (214), Expect = 2e-15 Identities = 42/50 (84%), Positives = 45/50 (90%) Frame = +3 Query: 207 VNIRCSNGSKFQVKTSLESTVVDFKGLLAQNCDVPAEQQRLIYKGRILKD 356 VNIRCSNGSKF V+T LESTV FK LLAQNCDVP++QQRLIYKGRILKD Sbjct: 19 VNIRCSNGSKFSVRTCLESTVGAFKALLAQNCDVPSDQQRLIYKGRILKD 68 >emb|CBI37753.3| unnamed protein product [Vitis vinifera] Length = 101 Score = 87.0 bits (214), Expect = 2e-15 Identities = 42/50 (84%), Positives = 45/50 (90%) Frame = +3 Query: 207 VNIRCSNGSKFQVKTSLESTVVDFKGLLAQNCDVPAEQQRLIYKGRILKD 356 VNIRCSNGSKF V+T LESTV FK LLAQNCDVP++QQRLIYKGRILKD Sbjct: 19 VNIRCSNGSKFSVRTCLESTVGAFKALLAQNCDVPSDQQRLIYKGRILKD 68 >ref|XP_006379369.1| hypothetical protein POPTR_0009s16750g [Populus trichocarpa] gi|550331879|gb|ERP57166.1| hypothetical protein POPTR_0009s16750g [Populus trichocarpa] Length = 561 Score = 85.9 bits (211), Expect = 5e-15 Identities = 41/50 (82%), Positives = 45/50 (90%) Frame = +3 Query: 207 VNIRCSNGSKFQVKTSLESTVVDFKGLLAQNCDVPAEQQRLIYKGRILKD 356 +NIRCSNG+KF V+TSLESTV FK LLAQNCDVP +QQRLIYKGRILKD Sbjct: 27 INIRCSNGTKFTVRTSLESTVGVFKSLLAQNCDVPPDQQRLIYKGRILKD 76 >ref|XP_006379368.1| hypothetical protein POPTR_0009s16750g [Populus trichocarpa] gi|550331878|gb|ERP57165.1| hypothetical protein POPTR_0009s16750g [Populus trichocarpa] Length = 558 Score = 85.9 bits (211), Expect = 5e-15 Identities = 41/50 (82%), Positives = 45/50 (90%) Frame = +3 Query: 207 VNIRCSNGSKFQVKTSLESTVVDFKGLLAQNCDVPAEQQRLIYKGRILKD 356 +NIRCSNG+KF V+TSLESTV FK LLAQNCDVP +QQRLIYKGRILKD Sbjct: 27 INIRCSNGTKFTVRTSLESTVGVFKSLLAQNCDVPPDQQRLIYKGRILKD 76 >gb|EPS67253.1| hypothetical protein M569_07523, partial [Genlisea aurea] Length = 327 Score = 85.9 bits (211), Expect = 5e-15 Identities = 40/50 (80%), Positives = 46/50 (92%) Frame = +3 Query: 207 VNIRCSNGSKFQVKTSLESTVVDFKGLLAQNCDVPAEQQRLIYKGRILKD 356 VN+R +NGSKF V TSL+STV +FKGLLA+NCD+PAEQQRLIYKGRILKD Sbjct: 21 VNVRSTNGSKFSVSTSLQSTVGEFKGLLARNCDIPAEQQRLIYKGRILKD 70 >gb|EPS65900.1| hypothetical protein M569_08869, partial [Genlisea aurea] Length = 538 Score = 85.5 bits (210), Expect = 7e-15 Identities = 42/50 (84%), Positives = 45/50 (90%) Frame = +3 Query: 207 VNIRCSNGSKFQVKTSLESTVVDFKGLLAQNCDVPAEQQRLIYKGRILKD 356 VNIR +NGSKF V TSLESTV +FK LLAQNCD+PAEQQRLIYKGRILKD Sbjct: 19 VNIRSTNGSKFSVNTSLESTVGEFKVLLAQNCDIPAEQQRLIYKGRILKD 68 >ref|XP_002263194.2| PREDICTED: uncharacterized protein LOC100250759 [Vitis vinifera] Length = 483 Score = 85.5 bits (210), Expect = 7e-15 Identities = 40/51 (78%), Positives = 46/51 (90%) Frame = +3 Query: 204 TVNIRCSNGSKFQVKTSLESTVVDFKGLLAQNCDVPAEQQRLIYKGRILKD 356 TV++RCSNGSKF V+ SLESTV FK +L+QNCD+PAEQQRLIYKGRILKD Sbjct: 20 TVHVRCSNGSKFSVQISLESTVRAFKAVLSQNCDIPAEQQRLIYKGRILKD 70 >emb|CBI38417.3| unnamed protein product [Vitis vinifera] Length = 127 Score = 85.5 bits (210), Expect = 7e-15 Identities = 40/51 (78%), Positives = 46/51 (90%) Frame = +3 Query: 204 TVNIRCSNGSKFQVKTSLESTVVDFKGLLAQNCDVPAEQQRLIYKGRILKD 356 TV++RCSNGSKF V+ SLESTV FK +L+QNCD+PAEQQRLIYKGRILKD Sbjct: 20 TVHVRCSNGSKFSVQISLESTVRAFKAVLSQNCDIPAEQQRLIYKGRILKD 70 >ref|XP_006412123.1| hypothetical protein EUTSA_v10024813mg [Eutrema salsugineum] gi|557113293|gb|ESQ53576.1| hypothetical protein EUTSA_v10024813mg [Eutrema salsugineum] Length = 558 Score = 84.3 bits (207), Expect = 2e-14 Identities = 39/51 (76%), Positives = 45/51 (88%) Frame = +3 Query: 204 TVNIRCSNGSKFQVKTSLESTVVDFKGLLAQNCDVPAEQQRLIYKGRILKD 356 +VN+RCSNGSKF V+T L+STV FK L+AQ+CDVPA QQRLIYKGRILKD Sbjct: 25 SVNVRCSNGSKFSVRTCLDSTVESFKALVAQSCDVPANQQRLIYKGRILKD 75