BLASTX nr result
ID: Mentha23_contig00017121
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00017121 (458 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB82942.1| putative plastid-lipid-associated protein 10 [Mor... 58 1e-06 >gb|EXB82942.1| putative plastid-lipid-associated protein 10 [Morus notabilis] Length = 282 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/39 (71%), Positives = 29/39 (74%) Frame = +3 Query: 6 RRSVGGLYYLSYLDRNMLLGRAXXXXXXXXXTKAQPFIC 122 RRSVGGLYYLSYLD NMLLGRA T+AQPFIC Sbjct: 244 RRSVGGLYYLSYLDSNMLLGRAVGSGGVFVFTRAQPFIC 282