BLASTX nr result
ID: Mentha23_contig00016856
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00016856 (418 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU45312.1| hypothetical protein MIMGU_mgv1a020920mg [Mimulus... 59 9e-07 >gb|EYU45312.1| hypothetical protein MIMGU_mgv1a020920mg [Mimulus guttatus] Length = 91 Score = 58.5 bits (140), Expect = 9e-07 Identities = 28/51 (54%), Positives = 36/51 (70%), Gaps = 1/51 (1%) Frame = +1 Query: 178 AAVKIDDLKKANG-GAVKTPSKAAKDRRTTRSPRFAVELDGVHCFETIVPY 327 AAVKIDDLKK + P K ++R+ R+PRFA E DG++CFETI+PY Sbjct: 41 AAVKIDDLKKGEEVNSSSPPPKKPENRQMIRAPRFAPEFDGIYCFETIIPY 91