BLASTX nr result
ID: Mentha23_contig00016654
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00016654 (328 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU22852.1| hypothetical protein MIMGU_mgv1a018507mg, partial... 81 2e-13 ref|XP_007019958.1| Uncharacterized protein TCM_036336 [Theobrom... 68 1e-09 ref|XP_007199267.1| hypothetical protein PRUPE_ppa022692mg [Prun... 67 3e-09 ref|XP_006371471.1| hypothetical protein POPTR_0019s11420g [Popu... 62 1e-07 ref|XP_002526836.1| hypothetical protein RCOM_0686540 [Ricinus c... 56 5e-06 >gb|EYU22852.1| hypothetical protein MIMGU_mgv1a018507mg, partial [Mimulus guttatus] Length = 140 Score = 80.9 bits (198), Expect = 2e-13 Identities = 47/91 (51%), Positives = 58/91 (63%), Gaps = 17/91 (18%) Frame = -1 Query: 265 DEDGEEKMDLLWEDLNEDQFA-----------------GNCEKFSDMKALKLSKRNGRMV 137 +E+ E+KMD+LWEDLN D+F+ G+ K S +KALKLSK N M Sbjct: 50 EEEDEDKMDMLWEDLN-DEFSRIGCGSKAQIRSDVSSPGSEVKISCVKALKLSKANRNMF 108 Query: 136 SGKKTSILVFIKILKKVFLMHNSQRAMKKKA 44 GKK SILVFIK+LKKVF+M NS R +KK A Sbjct: 109 DGKKPSILVFIKVLKKVFVMQNSHRTIKKHA 139 >ref|XP_007019958.1| Uncharacterized protein TCM_036336 [Theobroma cacao] gi|508725286|gb|EOY17183.1| Uncharacterized protein TCM_036336 [Theobroma cacao] Length = 176 Score = 68.2 bits (165), Expect = 1e-09 Identities = 36/83 (43%), Positives = 53/83 (63%), Gaps = 7/83 (8%) Frame = -1 Query: 292 AKERNCKSRDEDGEEKMDLLWEDLNED-------QFAGNCEKFSDMKALKLSKRNGRMVS 134 +K + K ED EEKMDLLWED NE+ + +G+ + +ALKLSK N M Sbjct: 75 SKVSSKKVAAEDEEEKMDLLWEDFNEELPTSRSSRSSGDMVELGCAQALKLSKNNAAMFP 134 Query: 133 GKKTSILVFIKILKKVFLMHNSQ 65 ++ +LVF+++L+K+FL+HNSQ Sbjct: 135 PRRPGMLVFMRVLRKLFLVHNSQ 157 >ref|XP_007199267.1| hypothetical protein PRUPE_ppa022692mg [Prunus persica] gi|462394667|gb|EMJ00466.1| hypothetical protein PRUPE_ppa022692mg [Prunus persica] Length = 182 Score = 66.6 bits (161), Expect = 3e-09 Identities = 39/103 (37%), Positives = 60/103 (58%), Gaps = 15/103 (14%) Frame = -1 Query: 286 ERNCKSRDED-GEEKMDLLWEDLNED---------QFAGNCEK----FSDMKALKLSKRN 149 E++ +SRD D GEEKMD+LWED NE+ ++G + +KA KL++ N Sbjct: 77 EKDQESRDHDHGEEKMDMLWEDFNEELKSRSNTTSDYSGGLSREMLHLGCVKAFKLTETN 136 Query: 148 G-RMVSGKKTSILVFIKILKKVFLMHNSQRAMKKKASW*ILWC 23 G +S +K S++ +K+LK++F +HNS +KK A WC Sbjct: 137 GDHALSTRKPSVVAVMKVLKRLFFLHNSHHKLKKPA-----WC 174 >ref|XP_006371471.1| hypothetical protein POPTR_0019s11420g [Populus trichocarpa] gi|550317288|gb|ERP49268.1| hypothetical protein POPTR_0019s11420g [Populus trichocarpa] Length = 201 Score = 61.6 bits (148), Expect = 1e-07 Identities = 33/85 (38%), Positives = 51/85 (60%), Gaps = 11/85 (12%) Frame = -1 Query: 259 DGEEKMDLLWEDLNEDQFAGNCEKFSDM----------KALKLSKRNGR-MVSGKKTSIL 113 D EEKMD+LWED N ++ S + KAL+LSK G ++S +K ++ Sbjct: 98 DKEEKMDMLWEDFNTEETLTRSHSSSRLDSEAVHMGCVKALRLSKPKGTSIISARKPGLV 157 Query: 112 VFIKILKKVFLMHNSQRAMKKKASW 38 VF+ +LK +FL+HNS R++K +S+ Sbjct: 158 VFMNVLKSLFLIHNSHRSVKHHSSY 182 >ref|XP_002526836.1| hypothetical protein RCOM_0686540 [Ricinus communis] gi|223533840|gb|EEF35571.1| hypothetical protein RCOM_0686540 [Ricinus communis] Length = 208 Score = 56.2 bits (134), Expect = 5e-06 Identities = 35/85 (41%), Positives = 48/85 (56%), Gaps = 20/85 (23%) Frame = -1 Query: 262 EDGEEKMDLLWEDLNED-------QFAGNCEKFSDM----------KALKLSKRNGRMVS 134 +D EEKMD+LWED NE+ Q + DM +++KL+K + MVS Sbjct: 97 DDKEEKMDMLWEDFNEEITSLKRSQSTSRFDSDHDMANRVGCVHQLQSVKLNKTSTAMVS 156 Query: 133 GKK---TSILVFIKILKKVFLMHNS 68 KK +VFIK+LKK+FL+HNS Sbjct: 157 PKKPATAGFVVFIKVLKKLFLLHNS 181