BLASTX nr result
ID: Mentha23_contig00016611
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00016611 (308 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU46369.1| hypothetical protein MIMGU_mgv1a0120571mg, partia... 57 2e-06 >gb|EYU46369.1| hypothetical protein MIMGU_mgv1a0120571mg, partial [Mimulus guttatus] Length = 85 Score = 57.4 bits (137), Expect = 2e-06 Identities = 29/44 (65%), Positives = 33/44 (75%) Frame = -3 Query: 306 SGQASGSTRGDSDIWSSRMREKYGLNNIGGDAKQNMLNPKASAD 175 S Q S S RGDSDIWSSRMR+KYGLN+ GDAK ++LN S D Sbjct: 42 SSQTSPSIRGDSDIWSSRMRDKYGLNS--GDAKHSLLNQNQSND 83