BLASTX nr result
ID: Mentha23_contig00016535
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00016535 (367 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007028975.1| DNA-binding bromodomain-containing protein, ... 63 4e-08 >ref|XP_007028975.1| DNA-binding bromodomain-containing protein, putative [Theobroma cacao] gi|508717580|gb|EOY09477.1| DNA-binding bromodomain-containing protein, putative [Theobroma cacao] Length = 693 Score = 63.2 bits (152), Expect = 4e-08 Identities = 33/72 (45%), Positives = 51/72 (70%) Frame = +1 Query: 1 KSQSTSDSKKRGAANFLSRMKQGSSSNNGVLLDALKNTPLTSESTTGKGGSDQKKNEPAK 180 K+ + SKKR AANFL+RM++ SSSNNG L++ LK ++S++ G GG +QKKN +K Sbjct: 564 KTNANISSKKRSAANFLNRMRRSSSSNNGPLIETLKGV-ISSDNGKGDGG-EQKKNSNSK 621 Query: 181 RGEKKELVTTRR 216 ++K+ ++T R Sbjct: 622 GDQRKDQISTPR 633