BLASTX nr result
ID: Mentha23_contig00015851
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00015851 (413 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU33386.1| hypothetical protein MIMGU_mgv1a005762mg [Mimulus... 88 1e-15 >gb|EYU33386.1| hypothetical protein MIMGU_mgv1a005762mg [Mimulus guttatus] Length = 471 Score = 87.8 bits (216), Expect = 1e-15 Identities = 44/61 (72%), Positives = 49/61 (80%), Gaps = 4/61 (6%) Frame = -3 Query: 411 HLQRYSDGSAPSFFLGTAEP---HHQFLPGYDSRG-FQLCYGDAAHANNGRNSAQRGKGK 244 HLQR+SDGS PSFF+ TA P HHQFL GYD+ G QLCYGD AHANNGR+S Q+GKGK Sbjct: 412 HLQRFSDGSPPSFFVSTAAPVENHHQFLSGYDAAGRLQLCYGD-AHANNGRHSGQKGKGK 470 Query: 243 N 241 N Sbjct: 471 N 471