BLASTX nr result
ID: Mentha23_contig00015674
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00015674 (413 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU46823.1| hypothetical protein MIMGU_mgv1a001306mg [Mimulus... 57 2e-06 >gb|EYU46823.1| hypothetical protein MIMGU_mgv1a001306mg [Mimulus guttatus] Length = 843 Score = 57.4 bits (137), Expect = 2e-06 Identities = 30/47 (63%), Positives = 35/47 (74%), Gaps = 3/47 (6%) Frame = +1 Query: 1 GSVVAAWLRESGTLKVLVLQDDR---DPVRSSDARFDLVSDFQPVLL 132 GSVV AWLRESG+LKVLVLQDDR + SS RFD + +FQP+ L Sbjct: 797 GSVVTAWLRESGSLKVLVLQDDRTHTGTISSSSTRFDRIPNFQPLPL 843