BLASTX nr result
ID: Mentha23_contig00015122
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00015122 (324 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU18807.1| hypothetical protein MIMGU_mgv1a002578mg [Mimulus... 55 8e-06 >gb|EYU18807.1| hypothetical protein MIMGU_mgv1a002578mg [Mimulus guttatus] Length = 657 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/37 (64%), Positives = 29/37 (78%) Frame = +2 Query: 197 MDMSDFRPQFHIAQQSRRDKLRIQQDFTFSHHNLGPY 307 MDMS+FRP+ H+AQQSRRDKLRIQ + HHN+ Y Sbjct: 1 MDMSNFRPELHVAQQSRRDKLRIQHESNGPHHNIEVY 37