BLASTX nr result
ID: Mentha23_contig00014788
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00014788 (789 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU40058.1| hypothetical protein MIMGU_mgv1a024669mg, partial... 77 5e-12 >gb|EYU40058.1| hypothetical protein MIMGU_mgv1a024669mg, partial [Mimulus guttatus] Length = 512 Score = 77.4 bits (189), Expect = 5e-12 Identities = 44/77 (57%), Positives = 53/77 (68%), Gaps = 3/77 (3%) Frame = -3 Query: 787 CSTSKVAADECSSIHAAAQTLIDMGAYSKENPCAVVKLLKKPSQIIMKATKSKAIKRCDF 608 CSTSK+ ADE S AAAQTL+D+ A++K NPCA VK LK+ Q +KA KSKAI++ D Sbjct: 436 CSTSKIIADEHSIARAAAQTLLDIAAFAKGNPCASVKSLKRHPQTAIKACKSKAIEQSDK 495 Query: 607 DL---PNSRIRPTNSLK 566 L P S RPTN LK Sbjct: 496 LLDQAPKSTKRPTNPLK 512