BLASTX nr result
ID: Mentha23_contig00014786
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00014786 (417 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAJ38401.1| BAG-domain protein 1 / regulator of cell death [... 67 4e-10 >emb|CAJ38401.1| BAG-domain protein 1 / regulator of cell death [Plantago major] Length = 159 Score = 67.4 bits (163), Expect(2) = 4e-10 Identities = 38/69 (55%), Positives = 47/69 (68%), Gaps = 2/69 (2%) Frame = +1 Query: 10 SNGNLVSPQAKQNHSNGNASSP--SHHHRNSSMQSLGDSLIDCDSPKQQSQPSRHSASGS 183 SNG++ SP ++ +SNG+ SSP S R+S QSL DSP ++ QPSRHSASGS Sbjct: 67 SNGSVYSPVHQRKYSNGSVSSPVQSQERRHSFGQSL------MDSPVKEQQPSRHSASGS 120 Query: 184 SVVITTQWE 210 VVITTQWE Sbjct: 121 DVVITTQWE 129 Score = 22.3 bits (46), Expect(2) = 4e-10 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = +2 Query: 239 STVRANQPSFSWNLL 283 ST RA QPSF+W+LL Sbjct: 146 STHRA-QPSFTWDLL 159