BLASTX nr result
ID: Mentha23_contig00014676
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00014676 (535 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU46779.1| hypothetical protein MIMGU_mgv1a0058492mg, partia... 58 2e-06 >gb|EYU46779.1| hypothetical protein MIMGU_mgv1a0058492mg, partial [Mimulus guttatus] Length = 364 Score = 57.8 bits (138), Expect = 2e-06 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = +1 Query: 1 DDEQVMSGDATQTGFNFGGADLPVPTGGFKFG 96 DD ++ SGDA+Q+GFNFGG+DLPVP GGFKFG Sbjct: 333 DDGELASGDASQSGFNFGGSDLPVPPGGFKFG 364