BLASTX nr result
ID: Mentha23_contig00014657
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00014657 (338 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004242326.1| PREDICTED: mitochondrial ubiquitin ligase ac... 126 4e-27 ref|XP_004242325.1| PREDICTED: mitochondrial ubiquitin ligase ac... 126 4e-27 ref|XP_006444143.1| hypothetical protein CICLE_v10020955mg [Citr... 124 1e-26 gb|EXB39322.1| GDSL esterase/lipase [Morus notabilis] 124 2e-26 ref|XP_004290684.1| PREDICTED: mitochondrial ubiquitin ligase ac... 123 3e-26 ref|XP_003518933.1| PREDICTED: mitochondrial ubiquitin ligase ac... 122 5e-26 ref|XP_002274008.1| PREDICTED: mitochondrial ubiquitin ligase ac... 122 5e-26 ref|XP_006352789.1| PREDICTED: mitochondrial ubiquitin ligase ac... 122 7e-26 ref|XP_006352786.1| PREDICTED: mitochondrial ubiquitin ligase ac... 122 7e-26 ref|XP_003536411.1| PREDICTED: mitochondrial ubiquitin ligase ac... 120 2e-25 ref|XP_006479780.1| PREDICTED: mitochondrial ubiquitin ligase ac... 120 3e-25 ref|XP_006444146.1| hypothetical protein CICLE_v10020957mg [Citr... 120 3e-25 ref|XP_006444145.1| hypothetical protein CICLE_v10020957mg [Citr... 120 3e-25 ref|XP_007144600.1| hypothetical protein PHAVU_007G1691001g, par... 116 3e-24 ref|XP_004164563.1| PREDICTED: mitochondrial ubiquitin ligase ac... 116 3e-24 ref|XP_004136066.1| PREDICTED: mitochondrial ubiquitin ligase ac... 116 3e-24 ref|XP_006658048.1| PREDICTED: mitochondrial ubiquitin ligase ac... 116 4e-24 gb|EEC82565.1| hypothetical protein OsI_27112 [Oryza sativa Indi... 115 5e-24 ref|XP_007050690.1| E3 Ubiquitin ligase family protein isoform 1... 115 6e-24 ref|XP_006415226.1| hypothetical protein EUTSA_v10008106mg [Eutr... 115 6e-24 >ref|XP_004242326.1| PREDICTED: mitochondrial ubiquitin ligase activator of nfkb 1-A-like isoform 2 [Solanum lycopersicum] Length = 341 Score = 126 bits (316), Expect = 4e-27 Identities = 53/57 (92%), Positives = 56/57 (98%) Frame = +2 Query: 11 NKDRMMPDLCVICLEQEYNSVFVPCGHMCCCMTCSAHLTNCPLCRRRIEQVVRTFRH 181 NKD +MPDLCVICLEQEYNSVFVPCGHMCCCMTCS+HLTNCPLCRRRIEQVV+TFRH Sbjct: 285 NKDLLMPDLCVICLEQEYNSVFVPCGHMCCCMTCSSHLTNCPLCRRRIEQVVKTFRH 341 >ref|XP_004242325.1| PREDICTED: mitochondrial ubiquitin ligase activator of nfkb 1-A-like isoform 1 [Solanum lycopersicum] Length = 349 Score = 126 bits (316), Expect = 4e-27 Identities = 53/57 (92%), Positives = 56/57 (98%) Frame = +2 Query: 11 NKDRMMPDLCVICLEQEYNSVFVPCGHMCCCMTCSAHLTNCPLCRRRIEQVVRTFRH 181 NKD +MPDLCVICLEQEYNSVFVPCGHMCCCMTCS+HLTNCPLCRRRIEQVV+TFRH Sbjct: 293 NKDLLMPDLCVICLEQEYNSVFVPCGHMCCCMTCSSHLTNCPLCRRRIEQVVKTFRH 349 >ref|XP_006444143.1| hypothetical protein CICLE_v10020955mg [Citrus clementina] gi|567903312|ref|XP_006444144.1| hypothetical protein CICLE_v10020955mg [Citrus clementina] gi|568852219|ref|XP_006479777.1| PREDICTED: mitochondrial ubiquitin ligase activator of nfkb 1-A-like [Citrus sinensis] gi|557546405|gb|ESR57383.1| hypothetical protein CICLE_v10020955mg [Citrus clementina] gi|557546406|gb|ESR57384.1| hypothetical protein CICLE_v10020955mg [Citrus clementina] Length = 344 Score = 124 bits (311), Expect = 1e-26 Identities = 51/60 (85%), Positives = 57/60 (95%) Frame = +2 Query: 2 DSTNKDRMMPDLCVICLEQEYNSVFVPCGHMCCCMTCSAHLTNCPLCRRRIEQVVRTFRH 181 D T +DR+MPDLCVICLEQEYN+VFVPCGHMCCC+ CS+HLTNCPLCRRRI+QVVRTFRH Sbjct: 285 DGTQRDRVMPDLCVICLEQEYNAVFVPCGHMCCCIICSSHLTNCPLCRRRIDQVVRTFRH 344 >gb|EXB39322.1| GDSL esterase/lipase [Morus notabilis] Length = 751 Score = 124 bits (310), Expect = 2e-26 Identities = 51/60 (85%), Positives = 57/60 (95%) Frame = +2 Query: 2 DSTNKDRMMPDLCVICLEQEYNSVFVPCGHMCCCMTCSAHLTNCPLCRRRIEQVVRTFRH 181 DS+ KDR+MPDLCVICLEQEYN+VFVPCGHMCCC TCS+ LTNCPLCRRRIEQ+V+TFRH Sbjct: 692 DSSKKDRLMPDLCVICLEQEYNAVFVPCGHMCCCTTCSSQLTNCPLCRRRIEQIVKTFRH 751 >ref|XP_004290684.1| PREDICTED: mitochondrial ubiquitin ligase activator of nfkb 1-A-like [Fragaria vesca subsp. vesca] Length = 342 Score = 123 bits (308), Expect = 3e-26 Identities = 51/60 (85%), Positives = 56/60 (93%) Frame = +2 Query: 2 DSTNKDRMMPDLCVICLEQEYNSVFVPCGHMCCCMTCSAHLTNCPLCRRRIEQVVRTFRH 181 ++ KDR+MPDLCVICLEQEYN+VFVPCGHMCCC TCS HLTNCPLCRRRIEQVV+TFRH Sbjct: 283 EAPKKDRLMPDLCVICLEQEYNAVFVPCGHMCCCTTCSLHLTNCPLCRRRIEQVVKTFRH 342 >ref|XP_003518933.1| PREDICTED: mitochondrial ubiquitin ligase activator of nfkb 1-like [Glycine max] Length = 339 Score = 122 bits (306), Expect = 5e-26 Identities = 50/60 (83%), Positives = 56/60 (93%) Frame = +2 Query: 2 DSTNKDRMMPDLCVICLEQEYNSVFVPCGHMCCCMTCSAHLTNCPLCRRRIEQVVRTFRH 181 D KDR+MPDLCVICLEQEYN+VFVPCGHMCCC TCS+HLTNCPLCRR+IE+VV+TFRH Sbjct: 280 DGVKKDRLMPDLCVICLEQEYNAVFVPCGHMCCCTTCSSHLTNCPLCRRQIEKVVKTFRH 339 >ref|XP_002274008.1| PREDICTED: mitochondrial ubiquitin ligase activator of nfkb 1 [Vitis vinifera] gi|296086688|emb|CBI32323.3| unnamed protein product [Vitis vinifera] Length = 343 Score = 122 bits (306), Expect = 5e-26 Identities = 51/60 (85%), Positives = 56/60 (93%) Frame = +2 Query: 2 DSTNKDRMMPDLCVICLEQEYNSVFVPCGHMCCCMTCSAHLTNCPLCRRRIEQVVRTFRH 181 D+T +DR+MPDLCVICLEQEYN+VFVPCGHMCCC CS+ LTNCPLCRRRIEQVVRTFRH Sbjct: 284 DNTKRDRLMPDLCVICLEQEYNAVFVPCGHMCCCTMCSSQLTNCPLCRRRIEQVVRTFRH 343 >ref|XP_006352789.1| PREDICTED: mitochondrial ubiquitin ligase activator of nfkb 1-like isoform X4 [Solanum tuberosum] Length = 320 Score = 122 bits (305), Expect = 7e-26 Identities = 51/56 (91%), Positives = 55/56 (98%) Frame = +2 Query: 14 KDRMMPDLCVICLEQEYNSVFVPCGHMCCCMTCSAHLTNCPLCRRRIEQVVRTFRH 181 KD +MP+LCVICLEQEYNSVFVPCGHMCCCMTCS+HLTNCPLCRRRIEQVV+TFRH Sbjct: 265 KDLLMPNLCVICLEQEYNSVFVPCGHMCCCMTCSSHLTNCPLCRRRIEQVVKTFRH 320 >ref|XP_006352786.1| PREDICTED: mitochondrial ubiquitin ligase activator of nfkb 1-like isoform X1 [Solanum tuberosum] gi|565372411|ref|XP_006352787.1| PREDICTED: mitochondrial ubiquitin ligase activator of nfkb 1-like isoform X2 [Solanum tuberosum] gi|565372413|ref|XP_006352788.1| PREDICTED: mitochondrial ubiquitin ligase activator of nfkb 1-like isoform X3 [Solanum tuberosum] Length = 342 Score = 122 bits (305), Expect = 7e-26 Identities = 51/56 (91%), Positives = 55/56 (98%) Frame = +2 Query: 14 KDRMMPDLCVICLEQEYNSVFVPCGHMCCCMTCSAHLTNCPLCRRRIEQVVRTFRH 181 KD +MP+LCVICLEQEYNSVFVPCGHMCCCMTCS+HLTNCPLCRRRIEQVV+TFRH Sbjct: 287 KDLLMPNLCVICLEQEYNSVFVPCGHMCCCMTCSSHLTNCPLCRRRIEQVVKTFRH 342 >ref|XP_003536411.1| PREDICTED: mitochondrial ubiquitin ligase activator of nfkb 1 isoform 1 [Glycine max] Length = 339 Score = 120 bits (301), Expect = 2e-25 Identities = 49/60 (81%), Positives = 55/60 (91%) Frame = +2 Query: 2 DSTNKDRMMPDLCVICLEQEYNSVFVPCGHMCCCMTCSAHLTNCPLCRRRIEQVVRTFRH 181 D KDR+MPDLCVICLEQEYN+VFVPCGHMCCC CS+HLTNCPLCRR+IE+VV+TFRH Sbjct: 280 DGAKKDRLMPDLCVICLEQEYNAVFVPCGHMCCCTACSSHLTNCPLCRRQIEKVVKTFRH 339 >ref|XP_006479780.1| PREDICTED: mitochondrial ubiquitin ligase activator of nfkb 1-A-like isoform X3 [Citrus sinensis] Length = 277 Score = 120 bits (300), Expect = 3e-25 Identities = 49/60 (81%), Positives = 56/60 (93%) Frame = +2 Query: 2 DSTNKDRMMPDLCVICLEQEYNSVFVPCGHMCCCMTCSAHLTNCPLCRRRIEQVVRTFRH 181 DST +DR+MPDLCVICLEQEYN+VF PCGH+CCC+ CS+ LTNCPLCRRRI+QVVRTFRH Sbjct: 218 DSTQRDRVMPDLCVICLEQEYNAVFFPCGHLCCCLICSSRLTNCPLCRRRIDQVVRTFRH 277 >ref|XP_006444146.1| hypothetical protein CICLE_v10020957mg [Citrus clementina] gi|557546408|gb|ESR57386.1| hypothetical protein CICLE_v10020957mg [Citrus clementina] Length = 245 Score = 120 bits (300), Expect = 3e-25 Identities = 49/60 (81%), Positives = 56/60 (93%) Frame = +2 Query: 2 DSTNKDRMMPDLCVICLEQEYNSVFVPCGHMCCCMTCSAHLTNCPLCRRRIEQVVRTFRH 181 DST +DR+MPDLCVICLEQEYN+VF PCGH+CCC+ CS+ LTNCPLCRRRI+QVVRTFRH Sbjct: 186 DSTQRDRVMPDLCVICLEQEYNAVFFPCGHLCCCLICSSRLTNCPLCRRRIDQVVRTFRH 245 >ref|XP_006444145.1| hypothetical protein CICLE_v10020957mg [Citrus clementina] gi|568852221|ref|XP_006479778.1| PREDICTED: mitochondrial ubiquitin ligase activator of nfkb 1-A-like isoform X1 [Citrus sinensis] gi|568852223|ref|XP_006479779.1| PREDICTED: mitochondrial ubiquitin ligase activator of nfkb 1-A-like isoform X2 [Citrus sinensis] gi|557546407|gb|ESR57385.1| hypothetical protein CICLE_v10020957mg [Citrus clementina] Length = 344 Score = 120 bits (300), Expect = 3e-25 Identities = 49/60 (81%), Positives = 56/60 (93%) Frame = +2 Query: 2 DSTNKDRMMPDLCVICLEQEYNSVFVPCGHMCCCMTCSAHLTNCPLCRRRIEQVVRTFRH 181 DST +DR+MPDLCVICLEQEYN+VF PCGH+CCC+ CS+ LTNCPLCRRRI+QVVRTFRH Sbjct: 285 DSTQRDRVMPDLCVICLEQEYNAVFFPCGHLCCCLICSSRLTNCPLCRRRIDQVVRTFRH 344 >ref|XP_007144600.1| hypothetical protein PHAVU_007G1691001g, partial [Phaseolus vulgaris] gi|561017790|gb|ESW16594.1| hypothetical protein PHAVU_007G1691001g, partial [Phaseolus vulgaris] Length = 226 Score = 116 bits (291), Expect = 3e-24 Identities = 47/60 (78%), Positives = 54/60 (90%) Frame = +2 Query: 2 DSTNKDRMMPDLCVICLEQEYNSVFVPCGHMCCCMTCSAHLTNCPLCRRRIEQVVRTFRH 181 D +D +MPDLCVICLEQEYN+VFVPCGHMCCC CS+HLTNCPLCRR+IE+VV+TFRH Sbjct: 167 DVAKRDHLMPDLCVICLEQEYNAVFVPCGHMCCCTACSSHLTNCPLCRRQIEKVVKTFRH 226 >ref|XP_004164563.1| PREDICTED: mitochondrial ubiquitin ligase activator of nfkb 1-like [Cucumis sativus] Length = 337 Score = 116 bits (291), Expect = 3e-24 Identities = 47/60 (78%), Positives = 54/60 (90%) Frame = +2 Query: 2 DSTNKDRMMPDLCVICLEQEYNSVFVPCGHMCCCMTCSAHLTNCPLCRRRIEQVVRTFRH 181 D T +DR MPDLCVICLE++YN+VFVPCGHMCCC+ C +HLTNCPLCRRRIE VV+TFRH Sbjct: 278 DGTKRDRSMPDLCVICLERDYNAVFVPCGHMCCCVACCSHLTNCPLCRRRIELVVKTFRH 337 >ref|XP_004136066.1| PREDICTED: mitochondrial ubiquitin ligase activator of nfkb 1-like [Cucumis sativus] Length = 342 Score = 116 bits (291), Expect = 3e-24 Identities = 47/60 (78%), Positives = 54/60 (90%) Frame = +2 Query: 2 DSTNKDRMMPDLCVICLEQEYNSVFVPCGHMCCCMTCSAHLTNCPLCRRRIEQVVRTFRH 181 D T +DR MPDLCVICLE++YN+VFVPCGHMCCC+ C +HLTNCPLCRRRIE VV+TFRH Sbjct: 283 DGTKRDRSMPDLCVICLERDYNAVFVPCGHMCCCVACCSHLTNCPLCRRRIELVVKTFRH 342 >ref|XP_006658048.1| PREDICTED: mitochondrial ubiquitin ligase activator of nfkb 1-like [Oryza brachyantha] Length = 343 Score = 116 bits (290), Expect = 4e-24 Identities = 49/61 (80%), Positives = 57/61 (93%), Gaps = 1/61 (1%) Frame = +2 Query: 2 DSTNK-DRMMPDLCVICLEQEYNSVFVPCGHMCCCMTCSAHLTNCPLCRRRIEQVVRTFR 178 DS+NK D+++ D+CVICLEQEYN+VFVPCGHMCCCM CS+HLTNCPLCRRRI+Q VRTFR Sbjct: 283 DSSNKKDQLVLDICVICLEQEYNAVFVPCGHMCCCMNCSSHLTNCPLCRRRIDQAVRTFR 342 Query: 179 H 181 H Sbjct: 343 H 343 >gb|EEC82565.1| hypothetical protein OsI_27112 [Oryza sativa Indica Group] gi|222637570|gb|EEE67702.1| hypothetical protein OsJ_25368 [Oryza sativa Japonica Group] Length = 343 Score = 115 bits (289), Expect = 5e-24 Identities = 49/61 (80%), Positives = 56/61 (91%), Gaps = 1/61 (1%) Frame = +2 Query: 2 DSTNK-DRMMPDLCVICLEQEYNSVFVPCGHMCCCMTCSAHLTNCPLCRRRIEQVVRTFR 178 DS NK D+++ D+CVICLEQEYN+VFVPCGHMCCCM CS+HLTNCPLCRRRI+Q VRTFR Sbjct: 283 DSNNKKDQLVLDICVICLEQEYNAVFVPCGHMCCCMNCSSHLTNCPLCRRRIDQAVRTFR 342 Query: 179 H 181 H Sbjct: 343 H 343 >ref|XP_007050690.1| E3 Ubiquitin ligase family protein isoform 1 [Theobroma cacao] gi|508702951|gb|EOX94847.1| E3 Ubiquitin ligase family protein isoform 1 [Theobroma cacao] Length = 342 Score = 115 bits (288), Expect = 6e-24 Identities = 46/58 (79%), Positives = 54/58 (93%) Frame = +2 Query: 8 TNKDRMMPDLCVICLEQEYNSVFVPCGHMCCCMTCSAHLTNCPLCRRRIEQVVRTFRH 181 + +DR+MPDLCVICLEQEYN+VF+ CGHMCCC TCS+HLTNCPLCRRRI+QVV+ FRH Sbjct: 285 SKRDRIMPDLCVICLEQEYNAVFIQCGHMCCCTTCSSHLTNCPLCRRRIDQVVKVFRH 342 >ref|XP_006415226.1| hypothetical protein EUTSA_v10008106mg [Eutrema salsugineum] gi|567145364|ref|XP_006415228.1| hypothetical protein EUTSA_v10008106mg [Eutrema salsugineum] gi|567145367|ref|XP_006415229.1| hypothetical protein EUTSA_v10008106mg [Eutrema salsugineum] gi|567145371|ref|XP_006415230.1| hypothetical protein EUTSA_v10008106mg [Eutrema salsugineum] gi|312283085|dbj|BAJ34408.1| unnamed protein product [Thellungiella halophila] gi|557092997|gb|ESQ33579.1| hypothetical protein EUTSA_v10008106mg [Eutrema salsugineum] gi|557092999|gb|ESQ33581.1| hypothetical protein EUTSA_v10008106mg [Eutrema salsugineum] gi|557093000|gb|ESQ33582.1| hypothetical protein EUTSA_v10008106mg [Eutrema salsugineum] gi|557093001|gb|ESQ33583.1| hypothetical protein EUTSA_v10008106mg [Eutrema salsugineum] Length = 344 Score = 115 bits (288), Expect = 6e-24 Identities = 47/60 (78%), Positives = 54/60 (90%) Frame = +2 Query: 2 DSTNKDRMMPDLCVICLEQEYNSVFVPCGHMCCCMTCSAHLTNCPLCRRRIEQVVRTFRH 181 DST K+ +PDLCVICLEQEYN+VFVPCGHMCCC CS HLT+CPLCRRRI+QVV+T+RH Sbjct: 285 DSTKKEDAVPDLCVICLEQEYNAVFVPCGHMCCCTACSCHLTSCPLCRRRIDQVVKTYRH 344