BLASTX nr result
ID: Mentha23_contig00014577
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00014577 (405 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007018035.1| Plant regulator RWP-RK family protein, putat... 58 1e-06 ref|XP_002510678.1| conserved hypothetical protein [Ricinus comm... 58 1e-06 >ref|XP_007018035.1| Plant regulator RWP-RK family protein, putative [Theobroma cacao] gi|508723363|gb|EOY15260.1| Plant regulator RWP-RK family protein, putative [Theobroma cacao] Length = 952 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/42 (64%), Positives = 30/42 (71%) Frame = -2 Query: 230 MEEGVLPLSNILSNQSDSFMDFDYMDELLLDGCWLEAANGSE 105 ++ G+ P S IL S S MDFDYMDEL LDGCWLE A GSE Sbjct: 18 LKTGIHPRSAILGGPSYSAMDFDYMDELFLDGCWLETAEGSE 59 >ref|XP_002510678.1| conserved hypothetical protein [Ricinus communis] gi|223551379|gb|EEF52865.1| conserved hypothetical protein [Ricinus communis] Length = 949 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/42 (61%), Positives = 31/42 (73%) Frame = -2 Query: 230 MEEGVLPLSNILSNQSDSFMDFDYMDELLLDGCWLEAANGSE 105 MEEGV +L + DS MDFDYMD+LLL+GCWLE +GSE Sbjct: 1 MEEGVFSPGTMLGTRVDSAMDFDYMDKLLLEGCWLETIDGSE 42