BLASTX nr result
ID: Mentha23_contig00014542
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00014542 (364 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU42024.1| hypothetical protein MIMGU_mgv1a025364mg, partial... 98 1e-18 >gb|EYU42024.1| hypothetical protein MIMGU_mgv1a025364mg, partial [Mimulus guttatus] Length = 203 Score = 98.2 bits (243), Expect = 1e-18 Identities = 59/117 (50%), Positives = 71/117 (60%), Gaps = 1/117 (0%) Frame = -1 Query: 364 FVSTTCNASL-VFHIRKLIASEGNNASATSQVPPIASPVNGSSTNTNTSLINAEKPQIEK 188 FVS TCNAS VF +RKLI E NNA+ T +V P SP N + TN INA + EK Sbjct: 15 FVSNTCNASSSVFRLRKLIDGESNNATRTPKVSPTGSPANETKTNP----INAGDSEGEK 70 Query: 187 QKESQTRNQTNNSTVPLPVDPKGSNKPDNDTKSLGAPSPPAGEKKGSGVDGGSEKAN 17 KES +QTN++ P P D SNK DN ++S APSPPAG K + VDG S A+ Sbjct: 71 PKESPIGDQTNSTKTP-PTDSNNSNKTDNGSESSDAPSPPAGVKNDTTVDGKSGNAS 126