BLASTX nr result
ID: Mentha23_contig00014512
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00014512 (456 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU28826.1| hypothetical protein MIMGU_mgv1a009546mg [Mimulus... 77 3e-12 >gb|EYU28826.1| hypothetical protein MIMGU_mgv1a009546mg [Mimulus guttatus] Length = 339 Score = 77.0 bits (188), Expect = 3e-12 Identities = 40/69 (57%), Positives = 48/69 (69%) Frame = +1 Query: 250 MVQNSINTLVTSRCSVLCGSNDWSRRSSSQVRESYLVLGASRSCLCAYNGRGASFAGPCK 429 MVQ +INTLVTSRCSV+C S++ RR+ VRE + VLGA RSCLC+ + ASF GPC Sbjct: 1 MVQVAINTLVTSRCSVVCESSNLWRRNFGVVREHHAVLGAGRSCLCSSVEKDASFVGPCH 60 Query: 430 KFPRSGLRV 456 P LRV Sbjct: 61 VSPPRSLRV 69