BLASTX nr result
ID: Mentha23_contig00014440
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00014440 (457 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU45312.1| hypothetical protein MIMGU_mgv1a020920mg [Mimulus... 61 2e-07 >gb|EYU45312.1| hypothetical protein MIMGU_mgv1a020920mg [Mimulus guttatus] Length = 91 Score = 60.8 bits (146), Expect = 2e-07 Identities = 31/54 (57%), Positives = 40/54 (74%), Gaps = 3/54 (5%) Frame = -1 Query: 451 AAAVKIDDLKKAKGEAVKT---PSKAAKDRRTTRSPRFAVELDGVHCFETLVPY 299 AAAVKIDDLKK GE V + P K ++R+ R+PRFA E DG++CFET++PY Sbjct: 40 AAAVKIDDLKK--GEEVNSSSPPPKKPENRQMIRAPRFAPEFDGIYCFETIIPY 91