BLASTX nr result
ID: Mentha23_contig00014230
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00014230 (364 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU34365.1| hypothetical protein MIMGU_mgv1a0238131mg, partia... 77 2e-12 >gb|EYU34365.1| hypothetical protein MIMGU_mgv1a0238131mg, partial [Mimulus guttatus] Length = 228 Score = 77.4 bits (189), Expect = 2e-12 Identities = 37/44 (84%), Positives = 38/44 (86%) Frame = -2 Query: 135 MESTRRPFDRSLSKEPGLKKPRLTEDPAAADRISNGRPGFVQRP 4 MESTRR FDRS+SKEPGLKKPRL EDP A DRISNGR G VQRP Sbjct: 1 MESTRRAFDRSMSKEPGLKKPRLIEDPTAQDRISNGRGGLVQRP 44