BLASTX nr result
ID: Mentha23_contig00014166
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00014166 (371 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS61145.1| hypothetical protein M569_13654 [Genlisea aurea] 55 8e-06 >gb|EPS61145.1| hypothetical protein M569_13654 [Genlisea aurea] Length = 565 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = -1 Query: 371 VKKMEELGTADGRSSGLVKIVDCGEMPNAKTQ 276 ++K+E LGTADGR SG+VKIVDCGEMP KTQ Sbjct: 157 IRKVEHLGTADGRPSGIVKIVDCGEMPQEKTQ 188