BLASTX nr result
ID: Mentha23_contig00014144
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00014144 (395 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU25685.1| hypothetical protein MIMGU_mgv1a011378mg [Mimulus... 63 4e-08 gb|EYU25684.1| hypothetical protein MIMGU_mgv1a011378mg [Mimulus... 63 4e-08 gb|EPS71039.1| hypothetical protein M569_03719, partial [Genlise... 60 3e-07 >gb|EYU25685.1| hypothetical protein MIMGU_mgv1a011378mg [Mimulus guttatus] Length = 209 Score = 63.2 bits (152), Expect = 4e-08 Identities = 27/45 (60%), Positives = 35/45 (77%) Frame = +3 Query: 6 HSGWPKTICGLDEGAQRCLYTNISEHIRGVMERLRVASGSRLKPN 140 HS WP+T+CG+DE AQRCLYTNIS+ I+ V+E+LR S + L N Sbjct: 165 HSEWPETVCGMDEAAQRCLYTNISDRIQLVLEKLRTVSKTCLNTN 209 >gb|EYU25684.1| hypothetical protein MIMGU_mgv1a011378mg [Mimulus guttatus] Length = 283 Score = 63.2 bits (152), Expect = 4e-08 Identities = 27/45 (60%), Positives = 35/45 (77%) Frame = +3 Query: 6 HSGWPKTICGLDEGAQRCLYTNISEHIRGVMERLRVASGSRLKPN 140 HS WP+T+CG+DE AQRCLYTNIS+ I+ V+E+LR S + L N Sbjct: 239 HSEWPETVCGMDEAAQRCLYTNISDRIQLVLEKLRTVSKTCLNTN 283 >gb|EPS71039.1| hypothetical protein M569_03719, partial [Genlisea aurea] Length = 277 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/41 (65%), Positives = 32/41 (78%) Frame = +3 Query: 12 GWPKTICGLDEGAQRCLYTNISEHIRGVMERLRVASGSRLK 134 GWP+T CGLDE AQ CLYT IS+ IRG ME+L A+ SR+K Sbjct: 237 GWPRTACGLDEAAQVCLYTTISDQIRGTMEKLCHAAKSRVK 277