BLASTX nr result
ID: Mentha23_contig00013941
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00013941 (326 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU32917.1| hypothetical protein MIMGU_mgv1a007724mg [Mimulus... 55 8e-06 >gb|EYU32917.1| hypothetical protein MIMGU_mgv1a007724mg [Mimulus guttatus] Length = 397 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/33 (72%), Positives = 28/33 (84%) Frame = +1 Query: 1 YELLAMGSLKEIRHAFARVVFDTIYPIDKYIND 99 YELL MGSL+E+RH FARVVFDTIYPID + + Sbjct: 365 YELLGMGSLREVRHVFARVVFDTIYPIDDQLEE 397