BLASTX nr result
ID: Mentha23_contig00013882
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00013882 (406 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU40575.1| hypothetical protein MIMGU_mgv1a004589mg [Mimulus... 53 1e-10 >gb|EYU40575.1| hypothetical protein MIMGU_mgv1a004589mg [Mimulus guttatus] Length = 519 Score = 52.8 bits (125), Expect(2) = 1e-10 Identities = 32/76 (42%), Positives = 36/76 (47%), Gaps = 15/76 (19%) Frame = +1 Query: 13 MKKLMAVGNINPKWSNE--------VGEDEFPIPQS-------XXXXXXXXXXXXXXXXS 147 +KKLMAVGN+NPKWS V E+ F IPQS S Sbjct: 382 IKKLMAVGNMNPKWSQNLNKSDQVAVAEEVFAIPQSLPPPPRVARMIPSPAVAAAPAAAS 441 Query: 148 FNAYEYFWRSKPGFMG 195 FNAYEYFWR+K G Sbjct: 442 FNAYEYFWRNKTAVYG 457 Score = 38.5 bits (88), Expect(2) = 1e-10 Identities = 19/26 (73%), Positives = 22/26 (84%), Gaps = 1/26 (3%) Frame = +3 Query: 228 SIHDMRGCKEARRSL-LREPYCIATS 302 S+ +RGCKEARRSL + EPYCIATS Sbjct: 494 SVPYLRGCKEARRSLSIWEPYCIATS 519