BLASTX nr result
ID: Mentha23_contig00013591
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00013591 (457 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU27456.1| hypothetical protein MIMGU_mgv1a010304mg [Mimulus... 67 2e-09 >gb|EYU27456.1| hypothetical protein MIMGU_mgv1a010304mg [Mimulus guttatus] Length = 316 Score = 67.4 bits (163), Expect = 2e-09 Identities = 46/104 (44%), Positives = 57/104 (54%), Gaps = 2/104 (1%) Frame = -3 Query: 401 KNIPEPSPTHQD-CSGESMKVDGVEGDILEDSRGKRK-EPATDKAEMASTMSSPGPANSH 228 K+ P P+ D S E+MKVD D+ E GKRK E A DK S H Sbjct: 220 KDSINPDPSSGDPVSDETMKVDESCDDVDEGVGGKRKGEEAMDK-------ESSDQETVH 272 Query: 227 DYGKSPFKSSPEGESHVTESDPLAAKDNVQMKYKRQRRSAPKQR 96 +Y KSP S +GES ++D ++ KD+VQ KYKR RRS PKQR Sbjct: 273 EYVKSPATSLTDGESVANKTDLVSGKDDVQRKYKRLRRSVPKQR 316