BLASTX nr result
ID: Mentha23_contig00013480
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00013480 (379 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU26999.1| hypothetical protein MIMGU_mgv1a022575mg [Mimulus... 57 3e-06 >gb|EYU26999.1| hypothetical protein MIMGU_mgv1a022575mg [Mimulus guttatus] Length = 190 Score = 57.0 bits (136), Expect = 3e-06 Identities = 30/61 (49%), Positives = 39/61 (63%) Frame = +3 Query: 192 MASAASVSMEIASSFVGLAKLRSYPIPSVKTAHFFSRNRLNLTAQSRKFLACAASANSRI 371 MAS S+S+E+A+SF+G AK +S PI S+ ++ F RNR N AQSRKF SR Sbjct: 1 MASITSLSVEMAASFLGFAKTQSSPISSIHSSLFLYRNRPNFFAQSRKFFTSTTYGGSRF 60 Query: 372 V 374 V Sbjct: 61 V 61