BLASTX nr result
ID: Mentha23_contig00013426
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00013426 (437 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006362498.1| PREDICTED: protein ABCI7, chloroplastic-like... 55 8e-06 ref|XP_004244542.1| PREDICTED: protein ABCI7, chloroplastic-like... 55 8e-06 >ref|XP_006362498.1| PREDICTED: protein ABCI7, chloroplastic-like [Solanum tuberosum] Length = 488 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/41 (63%), Positives = 34/41 (82%) Frame = +3 Query: 9 ARKALIFSFASEVIEHFPDVTLQKKVENLIRTLLTPALPSR 131 ARKALIFSFA+EV++ FP+ +++KKVE IR LL P+ PSR Sbjct: 448 ARKALIFSFAAEVVDRFPNASIRKKVETHIRELLDPSRPSR 488 >ref|XP_004244542.1| PREDICTED: protein ABCI7, chloroplastic-like [Solanum lycopersicum] Length = 485 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/41 (63%), Positives = 34/41 (82%) Frame = +3 Query: 9 ARKALIFSFASEVIEHFPDVTLQKKVENLIRTLLTPALPSR 131 ARKALIFSFA+EV++ FP+ +++KKVE IR LL P+ PSR Sbjct: 445 ARKALIFSFAAEVVDRFPNASIRKKVETHIRELLDPSRPSR 485