BLASTX nr result
ID: Mentha23_contig00013204
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00013204 (379 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS67477.1| shaggy kinase 7, partial [Genlisea aurea] 104 1e-20 gb|EYU32069.1| hypothetical protein MIMGU_mgv1a006024mg [Mimulus... 104 1e-20 gb|ABC94949.1| GSK-like kinase [Aegilops tauschii] gi|109290442|... 100 2e-19 gb|EMT00762.1| Glycogen synthase kinase-3-MsK-3-like protein [Ae... 100 3e-19 gb|EMS50777.1| Glycogen synthase kinase-3-like protein MsK-3 [Tr... 100 3e-19 ref|XP_003569078.1| PREDICTED: shaggy-related protein kinase gam... 100 3e-19 gb|ABG29422.1| GSK-like kinase 1A [Triticum aestivum] 100 3e-19 gb|ABG29426.1| GSK-like kinase 1 [Aegilops speltoides] 100 3e-19 gb|ABC94948.1| GSK-like kinase [Aegilops speltoides] 100 3e-19 gb|ABD97992.1| glycogen synthase kinase [Triticum monococcum sub... 100 3e-19 gb|AAM77397.1| GSK-like kinase [Triticum aestivum] 100 3e-19 ref|XP_006339456.1| PREDICTED: shaggy-related protein kinase the... 100 4e-19 ref|XP_004960405.1| PREDICTED: shaggy-related protein kinase alp... 100 4e-19 ref|XP_004229833.1| PREDICTED: shaggy-related protein kinase the... 100 4e-19 gb|AAT81407.1| shaggy-related protein kinase 6 [Solanum peruvianum] 100 4e-19 emb|CAA69899.1| NSK6 [Nicotiana tabacum] 100 4e-19 emb|CAA11860.1| shaggy-like kinase 91 [Nicotiana tabacum] 100 4e-19 gb|AAC24574.1| shaggy kinase homolog [Zea mays] 99 5e-19 tpg|DAA40481.1| TPA: putative protein kinase superfamily protein... 99 5e-19 ref|XP_003552357.1| PREDICTED: shaggy-related protein kinase the... 99 5e-19 >gb|EPS67477.1| shaggy kinase 7, partial [Genlisea aurea] Length = 404 Score = 104 bits (260), Expect = 1e-20 Identities = 48/51 (94%), Positives = 51/51 (100%) Frame = -1 Query: 379 MNPNYSEFKFPQIKAHPWHKVFHRKIPAEAVDLVSRLLQYSPTLRFTALEA 227 MNPNYSEFKFPQIKAHPWHKVF++K+PAEAVDLVSRLLQYSPTLRFTALEA Sbjct: 303 MNPNYSEFKFPQIKAHPWHKVFNKKMPAEAVDLVSRLLQYSPTLRFTALEA 353 >gb|EYU32069.1| hypothetical protein MIMGU_mgv1a006024mg [Mimulus guttatus] Length = 461 Score = 104 bits (259), Expect = 1e-20 Identities = 47/51 (92%), Positives = 50/51 (98%) Frame = -1 Query: 379 MNPNYSEFKFPQIKAHPWHKVFHRKIPAEAVDLVSRLLQYSPTLRFTALEA 227 MNPNYSEFKFPQIKAHPWHKVFH+++P EAVDLVSRLLQYSPTLRFTALEA Sbjct: 360 MNPNYSEFKFPQIKAHPWHKVFHKRMPPEAVDLVSRLLQYSPTLRFTALEA 410 >gb|ABC94949.1| GSK-like kinase [Aegilops tauschii] gi|109290442|gb|ABG29427.1| GSK-like kinase 1 [Aegilops tauschii] Length = 410 Score = 100 bits (250), Expect = 2e-19 Identities = 44/51 (86%), Positives = 50/51 (98%) Frame = -1 Query: 379 MNPNYSEFKFPQIKAHPWHKVFHRKIPAEAVDLVSRLLQYSPTLRFTALEA 227 MNPNY+EFKFPQIKAHPWHK+FH+++PAEAVDLVSRLLQYSP+LR TALEA Sbjct: 302 MNPNYTEFKFPQIKAHPWHKIFHKRVPAEAVDLVSRLLQYSPSLRSTALEA 352 >gb|EMT00762.1| Glycogen synthase kinase-3-MsK-3-like protein [Aegilops tauschii] Length = 397 Score = 100 bits (248), Expect = 3e-19 Identities = 44/51 (86%), Positives = 50/51 (98%) Frame = -1 Query: 379 MNPNYSEFKFPQIKAHPWHKVFHRKIPAEAVDLVSRLLQYSPTLRFTALEA 227 MNPNY+EFKFPQIKAHPWHK+FH+++PAEAVDLVSRLLQYSP+LR TALEA Sbjct: 289 MNPNYTEFKFPQIKAHPWHKIFHKRMPAEAVDLVSRLLQYSPSLRSTALEA 339 >gb|EMS50777.1| Glycogen synthase kinase-3-like protein MsK-3 [Triticum urartu] Length = 397 Score = 100 bits (248), Expect = 3e-19 Identities = 44/51 (86%), Positives = 50/51 (98%) Frame = -1 Query: 379 MNPNYSEFKFPQIKAHPWHKVFHRKIPAEAVDLVSRLLQYSPTLRFTALEA 227 MNPNY+EFKFPQIKAHPWHK+FH+++PAEAVDLVSRLLQYSP+LR TALEA Sbjct: 289 MNPNYTEFKFPQIKAHPWHKIFHKRMPAEAVDLVSRLLQYSPSLRSTALEA 339 >ref|XP_003569078.1| PREDICTED: shaggy-related protein kinase gamma-like [Brachypodium distachyon] Length = 411 Score = 100 bits (248), Expect = 3e-19 Identities = 44/51 (86%), Positives = 50/51 (98%) Frame = -1 Query: 379 MNPNYSEFKFPQIKAHPWHKVFHRKIPAEAVDLVSRLLQYSPTLRFTALEA 227 MNPNY+EFKFPQIKAHPWHK+FH+++PAEAVDLVSRLLQYSP+LR TALEA Sbjct: 303 MNPNYTEFKFPQIKAHPWHKIFHKRMPAEAVDLVSRLLQYSPSLRSTALEA 353 >gb|ABG29422.1| GSK-like kinase 1A [Triticum aestivum] Length = 410 Score = 100 bits (248), Expect = 3e-19 Identities = 44/51 (86%), Positives = 50/51 (98%) Frame = -1 Query: 379 MNPNYSEFKFPQIKAHPWHKVFHRKIPAEAVDLVSRLLQYSPTLRFTALEA 227 MNPNY+EFKFPQIKAHPWHK+FH+++PAEAVDLVSRLLQYSP+LR TALEA Sbjct: 302 MNPNYTEFKFPQIKAHPWHKIFHKRMPAEAVDLVSRLLQYSPSLRSTALEA 352 >gb|ABG29426.1| GSK-like kinase 1 [Aegilops speltoides] Length = 410 Score = 100 bits (248), Expect = 3e-19 Identities = 44/51 (86%), Positives = 50/51 (98%) Frame = -1 Query: 379 MNPNYSEFKFPQIKAHPWHKVFHRKIPAEAVDLVSRLLQYSPTLRFTALEA 227 MNPNY+EFKFPQIKAHPWHK+FH+++PAEAVDLVSRLLQYSP+LR TALEA Sbjct: 302 MNPNYTEFKFPQIKAHPWHKIFHKRMPAEAVDLVSRLLQYSPSLRSTALEA 352 >gb|ABC94948.1| GSK-like kinase [Aegilops speltoides] Length = 381 Score = 100 bits (248), Expect = 3e-19 Identities = 44/51 (86%), Positives = 50/51 (98%) Frame = -1 Query: 379 MNPNYSEFKFPQIKAHPWHKVFHRKIPAEAVDLVSRLLQYSPTLRFTALEA 227 MNPNY+EFKFPQIKAHPWHK+FH+++PAEAVDLVSRLLQYSP+LR TALEA Sbjct: 273 MNPNYTEFKFPQIKAHPWHKIFHKRMPAEAVDLVSRLLQYSPSLRSTALEA 323 >gb|ABD97992.1| glycogen synthase kinase [Triticum monococcum subsp. aegilopoides] Length = 355 Score = 100 bits (248), Expect = 3e-19 Identities = 44/51 (86%), Positives = 50/51 (98%) Frame = -1 Query: 379 MNPNYSEFKFPQIKAHPWHKVFHRKIPAEAVDLVSRLLQYSPTLRFTALEA 227 MNPNY+EFKFPQIKAHPWHK+FH+++PAEAVDLVSRLLQYSP+LR TALEA Sbjct: 273 MNPNYTEFKFPQIKAHPWHKIFHKRMPAEAVDLVSRLLQYSPSLRSTALEA 323 >gb|AAM77397.1| GSK-like kinase [Triticum aestivum] Length = 381 Score = 100 bits (248), Expect = 3e-19 Identities = 44/51 (86%), Positives = 50/51 (98%) Frame = -1 Query: 379 MNPNYSEFKFPQIKAHPWHKVFHRKIPAEAVDLVSRLLQYSPTLRFTALEA 227 MNPNY+EFKFPQIKAHPWHK+FH+++PAEAVDLVSRLLQYSP+LR TALEA Sbjct: 273 MNPNYTEFKFPQIKAHPWHKIFHKRMPAEAVDLVSRLLQYSPSLRSTALEA 323 >ref|XP_006339456.1| PREDICTED: shaggy-related protein kinase theta-like [Solanum tuberosum] Length = 475 Score = 99.8 bits (247), Expect = 4e-19 Identities = 44/51 (86%), Positives = 49/51 (96%) Frame = -1 Query: 379 MNPNYSEFKFPQIKAHPWHKVFHRKIPAEAVDLVSRLLQYSPTLRFTALEA 227 MNPNY+EFKFPQIKAHPWHK+FH+++P EAVDLVSRLLQYSPTLR TALEA Sbjct: 374 MNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPTLRCTALEA 424 >ref|XP_004960405.1| PREDICTED: shaggy-related protein kinase alpha-like [Setaria italica] Length = 410 Score = 99.8 bits (247), Expect = 4e-19 Identities = 44/51 (86%), Positives = 49/51 (96%) Frame = -1 Query: 379 MNPNYSEFKFPQIKAHPWHKVFHRKIPAEAVDLVSRLLQYSPTLRFTALEA 227 MNPNY+EFKFPQIKAHPWHK+FH+++PAEAVDLVSRLLQYSP LR TALEA Sbjct: 302 MNPNYTEFKFPQIKAHPWHKIFHKRMPAEAVDLVSRLLQYSPNLRSTALEA 352 >ref|XP_004229833.1| PREDICTED: shaggy-related protein kinase theta-like [Solanum lycopersicum] Length = 475 Score = 99.8 bits (247), Expect = 4e-19 Identities = 44/51 (86%), Positives = 49/51 (96%) Frame = -1 Query: 379 MNPNYSEFKFPQIKAHPWHKVFHRKIPAEAVDLVSRLLQYSPTLRFTALEA 227 MNPNY+EFKFPQIKAHPWHK+FH+++P EAVDLVSRLLQYSPTLR TALEA Sbjct: 374 MNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPTLRCTALEA 424 >gb|AAT81407.1| shaggy-related protein kinase 6 [Solanum peruvianum] Length = 475 Score = 99.8 bits (247), Expect = 4e-19 Identities = 44/51 (86%), Positives = 49/51 (96%) Frame = -1 Query: 379 MNPNYSEFKFPQIKAHPWHKVFHRKIPAEAVDLVSRLLQYSPTLRFTALEA 227 MNPNY+EFKFPQIKAHPWHK+FH+++P EAVDLVSRLLQYSPTLR TALEA Sbjct: 374 MNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPTLRCTALEA 424 >emb|CAA69899.1| NSK6 [Nicotiana tabacum] Length = 471 Score = 99.8 bits (247), Expect = 4e-19 Identities = 44/51 (86%), Positives = 49/51 (96%) Frame = -1 Query: 379 MNPNYSEFKFPQIKAHPWHKVFHRKIPAEAVDLVSRLLQYSPTLRFTALEA 227 MNPNY+EFKFPQIKAHPWHK+FH+++P EAVDLVSRLLQYSPTLR TALEA Sbjct: 370 MNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPTLRCTALEA 420 >emb|CAA11860.1| shaggy-like kinase 91 [Nicotiana tabacum] Length = 471 Score = 99.8 bits (247), Expect = 4e-19 Identities = 44/51 (86%), Positives = 49/51 (96%) Frame = -1 Query: 379 MNPNYSEFKFPQIKAHPWHKVFHRKIPAEAVDLVSRLLQYSPTLRFTALEA 227 MNPNY+EFKFPQIKAHPWHK+FH+++P EAVDLVSRLLQYSPTLR TALEA Sbjct: 370 MNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPTLRCTALEA 420 >gb|AAC24574.1| shaggy kinase homolog [Zea mays] Length = 118 Score = 99.4 bits (246), Expect = 5e-19 Identities = 44/51 (86%), Positives = 49/51 (96%) Frame = -1 Query: 379 MNPNYSEFKFPQIKAHPWHKVFHRKIPAEAVDLVSRLLQYSPTLRFTALEA 227 MNPNY+EFKFPQIKAHPWHK+FH+++PAEAVDLVSRLLQYSP LR TALEA Sbjct: 10 MNPNYTEFKFPQIKAHPWHKIFHKRMPAEAVDLVSRLLQYSPKLRSTALEA 60 >tpg|DAA40481.1| TPA: putative protein kinase superfamily protein [Zea mays] Length = 250 Score = 99.4 bits (246), Expect = 5e-19 Identities = 44/51 (86%), Positives = 49/51 (96%) Frame = -1 Query: 379 MNPNYSEFKFPQIKAHPWHKVFHRKIPAEAVDLVSRLLQYSPTLRFTALEA 227 MNPNY+EFKFPQIKAHPWHK+FH+++PAEAVDLVSRLLQYSP LR TALEA Sbjct: 142 MNPNYTEFKFPQIKAHPWHKIFHKRMPAEAVDLVSRLLQYSPKLRSTALEA 192 >ref|XP_003552357.1| PREDICTED: shaggy-related protein kinase theta-like [Glycine max] Length = 467 Score = 99.4 bits (246), Expect = 5e-19 Identities = 44/51 (86%), Positives = 49/51 (96%) Frame = -1 Query: 379 MNPNYSEFKFPQIKAHPWHKVFHRKIPAEAVDLVSRLLQYSPTLRFTALEA 227 MNPNY+EFKFPQIKAHPWHKVFH+K+P+EAVDLVSR+LQYSP LR TALEA Sbjct: 366 MNPNYTEFKFPQIKAHPWHKVFHKKMPSEAVDLVSRMLQYSPNLRCTALEA 416