BLASTX nr result
ID: Mentha23_contig00013148
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00013148 (428 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006350776.1| PREDICTED: PGR5-like protein 1B, chloroplast... 55 1e-05 ref|XP_004241224.1| PREDICTED: PGR5-like protein 1B, chloroplast... 55 1e-05 >ref|XP_006350776.1| PREDICTED: PGR5-like protein 1B, chloroplastic-like [Solanum tuberosum] Length = 286 Score = 55.1 bits (131), Expect = 1e-05 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = -1 Query: 428 RTKVEQSISRPGKRWVYGRIYLVRRGRRQRW 336 +TKVEQSISRPG+RWVYGR+YL+R +RQRW Sbjct: 257 QTKVEQSISRPGRRWVYGRVYLIR--QRQRW 285 >ref|XP_004241224.1| PREDICTED: PGR5-like protein 1B, chloroplastic-like [Solanum lycopersicum] Length = 286 Score = 55.1 bits (131), Expect = 1e-05 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = -1 Query: 428 RTKVEQSISRPGKRWVYGRIYLVRRGRRQRW 336 +TKVEQSISRPG+RWVYGR+YL+R +RQRW Sbjct: 257 QTKVEQSISRPGRRWVYGRVYLIR--QRQRW 285