BLASTX nr result
ID: Mentha23_contig00013066
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00013066 (302 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU38748.1| hypothetical protein MIMGU_mgv1a014393mg [Mimulus... 81 2e-13 gb|EYU18220.1| hypothetical protein MIMGU_mgv1a013427mg [Mimulus... 69 7e-10 gb|EPS68910.1| hypothetical protein M569_05860, partial [Genlise... 59 9e-07 >gb|EYU38748.1| hypothetical protein MIMGU_mgv1a014393mg [Mimulus guttatus] gi|604334665|gb|EYU38749.1| hypothetical protein MIMGU_mgv1a014393mg [Mimulus guttatus] Length = 191 Score = 80.9 bits (198), Expect = 2e-13 Identities = 31/60 (51%), Positives = 48/60 (80%) Frame = +3 Query: 3 SSGGIGRSRGPVVDFMSDDEQKAFNSTKGWPSSAFFLEGTSPVHPLPIVKLEMKIQDNEE 182 +S G+GR RG +D S+DE AF S KGWPSS+F+++GT P+HP+P++++E++IQ NE+ Sbjct: 117 ASSGVGRDRGSPLDLFSEDENMAFTSAKGWPSSSFYIQGTPPLHPIPVMEIEVQIQGNED 176 >gb|EYU18220.1| hypothetical protein MIMGU_mgv1a013427mg [Mimulus guttatus] Length = 220 Score = 68.9 bits (167), Expect = 7e-10 Identities = 27/47 (57%), Positives = 39/47 (82%) Frame = +3 Query: 42 DFMSDDEQKAFNSTKGWPSSAFFLEGTSPVHPLPIVKLEMKIQDNEE 182 D +S+DEQ + S KGWPS+A F+EGTSPVHP+P+V++ + IQ+NE+ Sbjct: 161 DLLSEDEQMSLTSAKGWPSTAVFIEGTSPVHPIPVVQMSVTIQNNED 207 >gb|EPS68910.1| hypothetical protein M569_05860, partial [Genlisea aurea] Length = 180 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/46 (56%), Positives = 38/46 (82%), Gaps = 1/46 (2%) Frame = +3 Query: 48 MSDDEQKAFNST-KGWPSSAFFLEGTSPVHPLPIVKLEMKIQDNEE 182 +SDD+Q + NS+ KGWPSS FF+EG SP+ P++++EMK++DNEE Sbjct: 132 LSDDQQMSLNSSSKGWPSSVFFIEGISPI---PVMEMEMKVRDNEE 174