BLASTX nr result
ID: Mentha23_contig00013012
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00013012 (380 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU42666.1| hypothetical protein MIMGU_mgv1a007838mg [Mimulus... 67 3e-09 gb|EYU37695.1| hypothetical protein MIMGU_mgv1a008067mg [Mimulus... 60 2e-07 >gb|EYU42666.1| hypothetical protein MIMGU_mgv1a007838mg [Mimulus guttatus] Length = 393 Score = 67.0 bits (162), Expect = 3e-09 Identities = 31/34 (91%), Positives = 31/34 (91%) Frame = -1 Query: 380 EGWDIKFSGSLNGEPFASVRRRSPIRGIKHRSRL 279 EGWDIKFSGSLNGEP ASVRRRSP GIKHRSRL Sbjct: 360 EGWDIKFSGSLNGEPVASVRRRSPFSGIKHRSRL 393 >gb|EYU37695.1| hypothetical protein MIMGU_mgv1a008067mg [Mimulus guttatus] Length = 386 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = -1 Query: 380 EGWDIKFSGSLNGEPFASVRRRSPIRGIKHRSRL 279 EGWDIKFSGSLNGEPF S+RRRS G+K RSRL Sbjct: 353 EGWDIKFSGSLNGEPFGSIRRRSTFSGMKQRSRL 386