BLASTX nr result
ID: Mentha23_contig00012574
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00012574 (462 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004287200.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-r... 60 2e-07 ref|XP_002521533.1| ring finger protein, putative [Ricinus commu... 60 3e-07 ref|XP_007043263.1| RING/U-box superfamily protein [Theobroma ca... 59 5e-07 ref|XP_002270577.2| PREDICTED: E3 ubiquitin ligase BIG BROTHER-r... 59 7e-07 emb|CBI29028.3| unnamed protein product [Vitis vinifera] 59 7e-07 ref|XP_007202272.1| hypothetical protein PRUPE_ppa008876mg [Prun... 59 9e-07 gb|EXC33997.1| E3 ubiquitin ligase BIG BROTHER-related protein [... 58 1e-06 emb|CAC10211.1| E3 ubiquitin ligase BIG BROTHER-related protein,... 57 2e-06 ref|XP_006437609.1| hypothetical protein CICLE_v10032094mg [Citr... 57 2e-06 ref|XP_007142774.1| hypothetical protein PHAVU_007G015800g [Phas... 57 2e-06 ref|XP_004497227.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-r... 57 2e-06 ref|XP_004497226.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-r... 57 2e-06 ref|XP_003555846.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-r... 56 6e-06 ref|XP_003555845.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-r... 56 6e-06 >ref|XP_004287200.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like [Fragaria vesca subsp. vesca] Length = 306 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = -2 Query: 89 GGNSQDAWGEVDPDELSYEELLALGEVVG 3 GGNSQDAW EVDPDELSYEELLALGEVVG Sbjct: 196 GGNSQDAWEEVDPDELSYEELLALGEVVG 224 >ref|XP_002521533.1| ring finger protein, putative [Ricinus communis] gi|223539211|gb|EEF40804.1| ring finger protein, putative [Ricinus communis] Length = 316 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -2 Query: 92 NGGNSQDAWGEVDPDELSYEELLALGEVVG 3 +GGNSQDAW EVDPDELSYEEL+ALGEVVG Sbjct: 205 HGGNSQDAWEEVDPDELSYEELIALGEVVG 234 >ref|XP_007043263.1| RING/U-box superfamily protein [Theobroma cacao] gi|508707198|gb|EOX99094.1| RING/U-box superfamily protein [Theobroma cacao] Length = 392 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -2 Query: 92 NGGNSQDAWGEVDPDELSYEELLALGEVVG 3 +GGNSQD W EVDPDELSYEELLALGEVVG Sbjct: 283 HGGNSQDTWEEVDPDELSYEELLALGEVVG 312 >ref|XP_002270577.2| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related [Vitis vinifera] Length = 452 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -2 Query: 92 NGGNSQDAWGEVDPDELSYEELLALGEVVG 3 +GGNSQD W EVDPDELSYEELLALGEV+G Sbjct: 343 HGGNSQDTWEEVDPDELSYEELLALGEVIG 372 >emb|CBI29028.3| unnamed protein product [Vitis vinifera] Length = 308 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -2 Query: 92 NGGNSQDAWGEVDPDELSYEELLALGEVVG 3 +GGNSQD W EVDPDELSYEELLALGEV+G Sbjct: 199 HGGNSQDTWEEVDPDELSYEELLALGEVIG 228 >ref|XP_007202272.1| hypothetical protein PRUPE_ppa008876mg [Prunus persica] gi|462397803|gb|EMJ03471.1| hypothetical protein PRUPE_ppa008876mg [Prunus persica] Length = 316 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -2 Query: 92 NGGNSQDAWGEVDPDELSYEELLALGEVVG 3 +GGNSQD W EVDPDELSYEEL+ALGEVVG Sbjct: 205 HGGNSQDTWEEVDPDELSYEELIALGEVVG 234 >gb|EXC33997.1| E3 ubiquitin ligase BIG BROTHER-related protein [Morus notabilis] Length = 342 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -2 Query: 92 NGGNSQDAWGEVDPDELSYEELLALGEVVG 3 +G NSQDAW EVDPDELSYEELLALGEVVG Sbjct: 231 SGDNSQDAWEEVDPDELSYEELLALGEVVG 260 >emb|CAC10211.1| E3 ubiquitin ligase BIG BROTHER-related protein, partial [Cicer arietinum] Length = 233 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -2 Query: 92 NGGNSQDAWGEVDPDELSYEELLALGEVVG 3 +G NSQDAW +VDPDELSYEELLALGEVVG Sbjct: 120 HGANSQDAWEDVDPDELSYEELLALGEVVG 149 >ref|XP_006437609.1| hypothetical protein CICLE_v10032094mg [Citrus clementina] gi|568862080|ref|XP_006484518.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like [Citrus sinensis] gi|557539805|gb|ESR50849.1| hypothetical protein CICLE_v10032094mg [Citrus clementina] Length = 328 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -2 Query: 92 NGGNSQDAWGEVDPDELSYEELLALGEVVG 3 +GG+SQD W EVDPDELSYEELLALGEVVG Sbjct: 217 HGGHSQDTWEEVDPDELSYEELLALGEVVG 246 >ref|XP_007142774.1| hypothetical protein PHAVU_007G015800g [Phaseolus vulgaris] gi|543176682|gb|AGV54364.1| RING-finger protein [Phaseolus vulgaris] gi|561015964|gb|ESW14768.1| hypothetical protein PHAVU_007G015800g [Phaseolus vulgaris] Length = 347 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -2 Query: 92 NGGNSQDAWGEVDPDELSYEELLALGEVVG 3 +G NSQDAW +VDPDELSYEELLALGEVVG Sbjct: 235 HGANSQDAWEDVDPDELSYEELLALGEVVG 264 >ref|XP_004497227.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like isoform X2 [Cicer arietinum] Length = 336 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -2 Query: 92 NGGNSQDAWGEVDPDELSYEELLALGEVVG 3 +G NSQDAW +VDPDELSYEELLALGEVVG Sbjct: 223 HGANSQDAWEDVDPDELSYEELLALGEVVG 252 >ref|XP_004497226.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like isoform X1 [Cicer arietinum] Length = 342 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -2 Query: 92 NGGNSQDAWGEVDPDELSYEELLALGEVVG 3 +G NSQDAW +VDPDELSYEELLALGEVVG Sbjct: 229 HGANSQDAWEDVDPDELSYEELLALGEVVG 258 >ref|XP_003555846.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like isoform 2 [Glycine max] Length = 341 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -2 Query: 92 NGGNSQDAWGEVDPDELSYEELLALGEVVG 3 +G NSQDAW +VDPDELSYEELLALGE VG Sbjct: 229 HGANSQDAWEDVDPDELSYEELLALGEAVG 258 >ref|XP_003555845.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like isoform 1 [Glycine max] Length = 335 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -2 Query: 92 NGGNSQDAWGEVDPDELSYEELLALGEVVG 3 +G NSQDAW +VDPDELSYEELLALGE VG Sbjct: 223 HGANSQDAWEDVDPDELSYEELLALGEAVG 252