BLASTX nr result
ID: Mentha23_contig00012519
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00012519 (337 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU33691.1| hypothetical protein MIMGU_mgv1a014165mg [Mimulus... 67 3e-09 gb|EXB67445.1| hypothetical protein L484_009525 [Morus notabilis] 57 3e-06 >gb|EYU33691.1| hypothetical protein MIMGU_mgv1a014165mg [Mimulus guttatus] Length = 198 Score = 66.6 bits (161), Expect = 3e-09 Identities = 36/53 (67%), Positives = 41/53 (77%), Gaps = 2/53 (3%) Frame = -3 Query: 335 GLNQRQSALAMPFSEST--RQQHHVYGALPPLAIPLANELKESFSSFCQSIGK 183 GLN++Q ALA+PFS S RQQ YG LPPLA P+ NELKESFSSFC+SI K Sbjct: 149 GLNKQQPALALPFSTSAVDRQQ---YGVLPPLAFPIPNELKESFSSFCRSIRK 198 >gb|EXB67445.1| hypothetical protein L484_009525 [Morus notabilis] Length = 208 Score = 56.6 bits (135), Expect = 3e-06 Identities = 31/57 (54%), Positives = 39/57 (68%), Gaps = 4/57 (7%) Frame = -3 Query: 335 GLNQRQSALAMPFSESTRQQHHVYGALPPLAIPLA----NELKESFSSFCQSIGKRD 177 GLN++Q ALA PFS T+ Q H PP+A+PL NELK +FSSFC+S+ KRD Sbjct: 146 GLNKQQPALAHPFSARTKSQRH--DIHPPMALPLQFPLPNELKGAFSSFCKSLQKRD 200