BLASTX nr result
ID: Mentha23_contig00012337
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00012337 (410 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU41807.1| hypothetical protein MIMGU_mgv1a010464mg [Mimulus... 69 9e-10 ref|XP_004249552.1| PREDICTED: phosphatidylinositol:ceramide ino... 57 4e-06 ref|XP_006339003.1| PREDICTED: phosphatidylinositol:ceramide ino... 56 5e-06 >gb|EYU41807.1| hypothetical protein MIMGU_mgv1a010464mg [Mimulus guttatus] Length = 311 Score = 68.6 bits (166), Expect = 9e-10 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = +2 Query: 2 SGDAADWRPRTQINGKIMEEGNVVHVEATINGV 100 SGD+ADWRPRTQINGKIMEEGNVVHVEA INGV Sbjct: 279 SGDSADWRPRTQINGKIMEEGNVVHVEAVINGV 311 >ref|XP_004249552.1| PREDICTED: phosphatidylinositol:ceramide inositolphosphotransferase 1-like [Solanum lycopersicum] Length = 312 Score = 56.6 bits (135), Expect = 4e-06 Identities = 24/31 (77%), Positives = 26/31 (83%) Frame = +2 Query: 8 DAADWRPRTQINGKIMEEGNVVHVEATINGV 100 D DWRPRTQING IME+GN VHVEA +NGV Sbjct: 279 DPEDWRPRTQINGMIMEDGNAVHVEAAVNGV 309 >ref|XP_006339003.1| PREDICTED: phosphatidylinositol:ceramide inositolphosphotransferase 1-like [Solanum tuberosum] Length = 309 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/33 (72%), Positives = 27/33 (81%) Frame = +2 Query: 2 SGDAADWRPRTQINGKIMEEGNVVHVEATINGV 100 + D DWRPRTQING IME+GN VHVEA +NGV Sbjct: 277 NADPEDWRPRTQINGMIMEDGNAVHVEAAMNGV 309