BLASTX nr result
ID: Mentha23_contig00012143
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00012143 (504 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU28813.1| hypothetical protein MIMGU_mgv1a003797mg [Mimulus... 60 3e-07 >gb|EYU28813.1| hypothetical protein MIMGU_mgv1a003797mg [Mimulus guttatus] Length = 563 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/47 (55%), Positives = 40/47 (85%) Frame = +1 Query: 1 GGEDSDRVPTRFLHRPNNWNNLLFGTEAERSSSRFTAPTTSSFSSHR 141 GGEDSDRVPTR ++R +NW++LLFG+E +R+ S++ P++SS ++HR Sbjct: 516 GGEDSDRVPTRIMNRSSNWSSLLFGSEPDRNVSKYMPPSSSS-NNHR 561