BLASTX nr result
ID: Mentha23_contig00012109
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00012109 (300 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU27458.1| hypothetical protein MIMGU_mgv1a004181mg [Mimulus... 58 1e-06 >gb|EYU27458.1| hypothetical protein MIMGU_mgv1a004181mg [Mimulus guttatus] Length = 540 Score = 58.2 bits (139), Expect = 1e-06 Identities = 32/81 (39%), Positives = 52/81 (64%), Gaps = 5/81 (6%) Frame = -2 Query: 299 GLQTGTMEPVPLMHSTAESSGVKGKPA--SEDTGASGSLDSHPEAGSSSLLKNNFNADKS 126 GLQ+GT+ PVP++ A+S+G +P + ++G +GS+DS E S+ L K ++ KS Sbjct: 283 GLQSGTLNPVPVVSERAQSTGTLSEPVLVTMESGRAGSVDSRAEDVSNLLPKTSYGIVKS 342 Query: 125 PSEVPEAR---LSPATSLMEN 72 P E+P A+ ++PATS + N Sbjct: 343 PREIPVAQPSIVAPATSSVAN 363