BLASTX nr result
ID: Mentha23_contig00012069
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00012069 (365 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU46268.1| hypothetical protein MIMGU_mgv1a012496mg [Mimulus... 99 5e-19 ref|XP_007150376.1| hypothetical protein PHAVU_005G148200g [Phas... 95 1e-17 ref|XP_007150374.1| hypothetical protein PHAVU_005G148200g [Phas... 95 1e-17 ref|XP_006470593.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-l... 92 1e-16 ref|XP_002303894.2| hypothetical protein POPTR_0003s20350g [Popu... 90 3e-16 ref|XP_007213834.1| hypothetical protein PRUPE_ppa010371mg [Prun... 90 3e-16 ref|XP_007132006.1| hypothetical protein PHAVU_011G058800g [Phas... 89 6e-16 ref|XP_002299230.1| hypothetical protein POPTR_0001s05710g [Popu... 88 1e-15 ref|XP_006356379.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-l... 87 2e-15 ref|XP_007014997.1| RING/U-box superfamily protein isoform 1 [Th... 87 2e-15 ref|XP_004165039.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-l... 87 2e-15 ref|XP_004151219.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-l... 87 2e-15 ref|XP_006591894.1| PREDICTED: uncharacterized protein LOC100805... 87 3e-15 ref|NP_001242183.1| uncharacterized protein LOC100805963 [Glycin... 86 5e-15 ref|XP_006590306.1| PREDICTED: uncharacterized protein LOC100793... 86 7e-15 ref|NP_001242079.1| uncharacterized protein LOC100793907 [Glycin... 86 7e-15 gb|AFK40026.1| unknown [Lotus japonicus] 85 1e-14 ref|XP_004250877.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-l... 84 2e-14 ref|XP_002285497.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER i... 84 2e-14 ref|XP_004507101.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-l... 84 3e-14 >gb|EYU46268.1| hypothetical protein MIMGU_mgv1a012496mg [Mimulus guttatus] Length = 249 Score = 99.4 bits (246), Expect = 5e-19 Identities = 40/47 (85%), Positives = 46/47 (97%) Frame = +2 Query: 17 KMEYKRGDRRMILPCKHLYHSGCGSRWLSINKACPICYKEVIVDVPK 157 +MEYKRGDRR+ LPCKHLYH+GCGSRWLSINKACPICYK+V+VD+PK Sbjct: 202 QMEYKRGDRRITLPCKHLYHTGCGSRWLSINKACPICYKDVVVDIPK 248 >ref|XP_007150376.1| hypothetical protein PHAVU_005G148200g [Phaseolus vulgaris] gi|593699877|ref|XP_007150377.1| hypothetical protein PHAVU_005G148200g [Phaseolus vulgaris] gi|561023640|gb|ESW22370.1| hypothetical protein PHAVU_005G148200g [Phaseolus vulgaris] gi|561023641|gb|ESW22371.1| hypothetical protein PHAVU_005G148200g [Phaseolus vulgaris] Length = 231 Score = 94.7 bits (234), Expect = 1e-17 Identities = 37/48 (77%), Positives = 45/48 (93%) Frame = +2 Query: 17 KMEYKRGDRRMILPCKHLYHSGCGSRWLSINKACPICYKEVIVDVPKH 160 +MEY+RGD+RM LPCKH YH+ CG++WLSINKACP+CY+EVIVDVPKH Sbjct: 183 QMEYRRGDKRMTLPCKHAYHASCGNKWLSINKACPMCYREVIVDVPKH 230 >ref|XP_007150374.1| hypothetical protein PHAVU_005G148200g [Phaseolus vulgaris] gi|593699873|ref|XP_007150375.1| hypothetical protein PHAVU_005G148200g [Phaseolus vulgaris] gi|593699879|ref|XP_007150378.1| hypothetical protein PHAVU_005G148200g [Phaseolus vulgaris] gi|561023638|gb|ESW22368.1| hypothetical protein PHAVU_005G148200g [Phaseolus vulgaris] gi|561023639|gb|ESW22369.1| hypothetical protein PHAVU_005G148200g [Phaseolus vulgaris] gi|561023642|gb|ESW22372.1| hypothetical protein PHAVU_005G148200g [Phaseolus vulgaris] Length = 246 Score = 94.7 bits (234), Expect = 1e-17 Identities = 37/48 (77%), Positives = 45/48 (93%) Frame = +2 Query: 17 KMEYKRGDRRMILPCKHLYHSGCGSRWLSINKACPICYKEVIVDVPKH 160 +MEY+RGD+RM LPCKH YH+ CG++WLSINKACP+CY+EVIVDVPKH Sbjct: 198 QMEYRRGDKRMTLPCKHAYHASCGNKWLSINKACPMCYREVIVDVPKH 245 >ref|XP_006470593.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-like [Citrus sinensis] Length = 256 Score = 91.7 bits (226), Expect = 1e-16 Identities = 38/48 (79%), Positives = 42/48 (87%) Frame = +2 Query: 17 KMEYKRGDRRMILPCKHLYHSGCGSRWLSINKACPICYKEVIVDVPKH 160 +MEYKRGDRRM LPCKH+YH+GCG+RWLSINKACPICY EV D KH Sbjct: 201 QMEYKRGDRRMTLPCKHVYHAGCGTRWLSINKACPICYTEVFGDSSKH 248 >ref|XP_002303894.2| hypothetical protein POPTR_0003s20350g [Populus trichocarpa] gi|566163724|ref|XP_006386020.1| hypothetical protein POPTR_0003s20350g [Populus trichocarpa] gi|566163726|ref|XP_006386021.1| hypothetical protein POPTR_0003s20350g [Populus trichocarpa] gi|566163728|ref|XP_006386022.1| hypothetical protein POPTR_0003s20350g [Populus trichocarpa] gi|550343616|gb|EEE78873.2| hypothetical protein POPTR_0003s20350g [Populus trichocarpa] gi|550343617|gb|ERP63817.1| hypothetical protein POPTR_0003s20350g [Populus trichocarpa] gi|550343618|gb|ERP63818.1| hypothetical protein POPTR_0003s20350g [Populus trichocarpa] gi|550343619|gb|ERP63819.1| hypothetical protein POPTR_0003s20350g [Populus trichocarpa] Length = 249 Score = 90.1 bits (222), Expect = 3e-16 Identities = 36/48 (75%), Positives = 42/48 (87%) Frame = +2 Query: 17 KMEYKRGDRRMILPCKHLYHSGCGSRWLSINKACPICYKEVIVDVPKH 160 +MEYKRGDR++ LPCKH+YH+GCG+RWLSINKACPICY EV D KH Sbjct: 202 QMEYKRGDRQITLPCKHIYHAGCGTRWLSINKACPICYSEVFGDASKH 249 >ref|XP_007213834.1| hypothetical protein PRUPE_ppa010371mg [Prunus persica] gi|462409699|gb|EMJ15033.1| hypothetical protein PRUPE_ppa010371mg [Prunus persica] Length = 252 Score = 90.1 bits (222), Expect = 3e-16 Identities = 37/47 (78%), Positives = 41/47 (87%) Frame = +2 Query: 17 KMEYKRGDRRMILPCKHLYHSGCGSRWLSINKACPICYKEVIVDVPK 157 +MEYKRGDRR+ LPCKHLYH+GCG+RWLSINKACPICY EV D K Sbjct: 203 QMEYKRGDRRITLPCKHLYHAGCGTRWLSINKACPICYTEVFADASK 249 >ref|XP_007132006.1| hypothetical protein PHAVU_011G058800g [Phaseolus vulgaris] gi|561005006|gb|ESW04000.1| hypothetical protein PHAVU_011G058800g [Phaseolus vulgaris] Length = 248 Score = 89.0 bits (219), Expect = 6e-16 Identities = 36/48 (75%), Positives = 41/48 (85%) Frame = +2 Query: 17 KMEYKRGDRRMILPCKHLYHSGCGSRWLSINKACPICYKEVIVDVPKH 160 +MEYKRGD+R+ LPCKHLYH+ CG+RWLSINKACPICY EV D KH Sbjct: 200 QMEYKRGDKRITLPCKHLYHASCGNRWLSINKACPICYTEVFADKSKH 247 >ref|XP_002299230.1| hypothetical protein POPTR_0001s05710g [Populus trichocarpa] gi|566147394|ref|XP_002299327.2| hypothetical protein POPTR_0001s05710g [Populus trichocarpa] gi|222846488|gb|EEE84035.1| hypothetical protein POPTR_0001s05710g [Populus trichocarpa] gi|550346587|gb|EEE84132.2| hypothetical protein POPTR_0001s05710g [Populus trichocarpa] Length = 263 Score = 88.2 bits (217), Expect = 1e-15 Identities = 35/48 (72%), Positives = 41/48 (85%) Frame = +2 Query: 17 KMEYKRGDRRMILPCKHLYHSGCGSRWLSINKACPICYKEVIVDVPKH 160 +MEYKRGDRR+ LPCKH+YH+GCG+RWL INKACPICY EV D +H Sbjct: 216 QMEYKRGDRRITLPCKHIYHAGCGTRWLCINKACPICYTEVFGDASRH 263 >ref|XP_006356379.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-like isoform X1 [Solanum tuberosum] gi|565379952|ref|XP_006356380.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-like isoform X2 [Solanum tuberosum] Length = 246 Score = 87.4 bits (215), Expect = 2e-15 Identities = 35/47 (74%), Positives = 42/47 (89%) Frame = +2 Query: 17 KMEYKRGDRRMILPCKHLYHSGCGSRWLSINKACPICYKEVIVDVPK 157 +MEYKR DR++ LPCKH+YHSGCGSRWLSINKACPICY EV+++ K Sbjct: 199 QMEYKRKDRQVTLPCKHVYHSGCGSRWLSINKACPICYSEVVINTSK 245 >ref|XP_007014997.1| RING/U-box superfamily protein isoform 1 [Theobroma cacao] gi|590583799|ref|XP_007014998.1| RING/U-box superfamily protein isoform 1 [Theobroma cacao] gi|508785360|gb|EOY32616.1| RING/U-box superfamily protein isoform 1 [Theobroma cacao] gi|508785361|gb|EOY32617.1| RING/U-box superfamily protein isoform 1 [Theobroma cacao] Length = 248 Score = 87.4 bits (215), Expect = 2e-15 Identities = 36/47 (76%), Positives = 41/47 (87%) Frame = +2 Query: 17 KMEYKRGDRRMILPCKHLYHSGCGSRWLSINKACPICYKEVIVDVPK 157 +MEYKRG+RR+ LPCKH+YH+GCGSRWLSINKACPICY EV D K Sbjct: 201 QMEYKRGERRITLPCKHVYHAGCGSRWLSINKACPICYTEVFGDASK 247 >ref|XP_004165039.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-like, partial [Cucumis sativus] Length = 138 Score = 87.0 bits (214), Expect = 2e-15 Identities = 35/47 (74%), Positives = 41/47 (87%) Frame = +2 Query: 17 KMEYKRGDRRMILPCKHLYHSGCGSRWLSINKACPICYKEVIVDVPK 157 +MEYKRGDRR+ LPCKH+YH+GCG++WLSINKACPICY EV D K Sbjct: 91 QMEYKRGDRRITLPCKHIYHAGCGTKWLSINKACPICYTEVFGDTSK 137 >ref|XP_004151219.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-like [Cucumis sativus] Length = 187 Score = 87.0 bits (214), Expect = 2e-15 Identities = 35/47 (74%), Positives = 41/47 (87%) Frame = +2 Query: 17 KMEYKRGDRRMILPCKHLYHSGCGSRWLSINKACPICYKEVIVDVPK 157 +MEYKRGDRR+ LPCKH+YH+GCG++WLSINKACPICY EV D K Sbjct: 140 QMEYKRGDRRITLPCKHIYHAGCGTKWLSINKACPICYTEVFGDTSK 186 >ref|XP_006591894.1| PREDICTED: uncharacterized protein LOC100805963 isoform X1 [Glycine max] gi|571491338|ref|XP_006591895.1| PREDICTED: uncharacterized protein LOC100805963 isoform X2 [Glycine max] gi|571491340|ref|XP_006591896.1| PREDICTED: uncharacterized protein LOC100805963 isoform X3 [Glycine max] gi|571491342|ref|XP_006591897.1| PREDICTED: uncharacterized protein LOC100805963 isoform X4 [Glycine max] gi|571491344|ref|XP_006591898.1| PREDICTED: uncharacterized protein LOC100805963 isoform X5 [Glycine max] Length = 248 Score = 86.7 bits (213), Expect = 3e-15 Identities = 34/48 (70%), Positives = 41/48 (85%) Frame = +2 Query: 17 KMEYKRGDRRMILPCKHLYHSGCGSRWLSINKACPICYKEVIVDVPKH 160 +MEYKRGD+R+ LPCKH+YH+ CG++WLSINKACPICY EV D KH Sbjct: 200 QMEYKRGDKRITLPCKHVYHASCGNKWLSINKACPICYTEVFADKSKH 247 >ref|NP_001242183.1| uncharacterized protein LOC100805963 [Glycine max] gi|255634943|gb|ACU17830.1| unknown [Glycine max] Length = 192 Score = 85.9 bits (211), Expect = 5e-15 Identities = 34/48 (70%), Positives = 40/48 (83%) Frame = +2 Query: 17 KMEYKRGDRRMILPCKHLYHSGCGSRWLSINKACPICYKEVIVDVPKH 160 +MEYKRGD R+ LPCKH+YH+ CG++WLSINKACPICY EV D KH Sbjct: 144 QMEYKRGDERITLPCKHVYHASCGNKWLSINKACPICYTEVFADKSKH 191 >ref|XP_006590306.1| PREDICTED: uncharacterized protein LOC100793907 isoform X1 [Glycine max] gi|571486372|ref|XP_006590307.1| PREDICTED: uncharacterized protein LOC100793907 isoform X2 [Glycine max] gi|571486374|ref|XP_006590308.1| PREDICTED: uncharacterized protein LOC100793907 isoform X3 [Glycine max] gi|571486376|ref|XP_006590309.1| PREDICTED: uncharacterized protein LOC100793907 isoform X4 [Glycine max] Length = 248 Score = 85.5 bits (210), Expect = 7e-15 Identities = 33/48 (68%), Positives = 41/48 (85%) Frame = +2 Query: 17 KMEYKRGDRRMILPCKHLYHSGCGSRWLSINKACPICYKEVIVDVPKH 160 +MEY+RGD+R+ LPCKH+YH+ CG++WLSINKACPICY EV D KH Sbjct: 200 QMEYRRGDKRITLPCKHVYHASCGNKWLSINKACPICYTEVFADKSKH 247 >ref|NP_001242079.1| uncharacterized protein LOC100793907 [Glycine max] gi|255635155|gb|ACU17934.1| unknown [Glycine max] Length = 248 Score = 85.5 bits (210), Expect = 7e-15 Identities = 33/48 (68%), Positives = 41/48 (85%) Frame = +2 Query: 17 KMEYKRGDRRMILPCKHLYHSGCGSRWLSINKACPICYKEVIVDVPKH 160 +MEY+RGD+R+ LPCKH+YH+ CG++WLSINKACPICY EV D KH Sbjct: 200 QMEYRRGDKRITLPCKHVYHASCGNKWLSINKACPICYTEVFADKSKH 247 >gb|AFK40026.1| unknown [Lotus japonicus] Length = 149 Score = 84.7 bits (208), Expect = 1e-14 Identities = 34/47 (72%), Positives = 40/47 (85%) Frame = +2 Query: 17 KMEYKRGDRRMILPCKHLYHSGCGSRWLSINKACPICYKEVIVDVPK 157 +MEYKRGD+R+ LPCKH+YH+ CG+RWLSINKACPICY EV D K Sbjct: 101 QMEYKRGDKRITLPCKHVYHASCGNRWLSINKACPICYTEVFADKSK 147 >ref|XP_004250877.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-like [Solanum lycopersicum] Length = 246 Score = 84.3 bits (207), Expect = 2e-14 Identities = 33/47 (70%), Positives = 42/47 (89%) Frame = +2 Query: 17 KMEYKRGDRRMILPCKHLYHSGCGSRWLSINKACPICYKEVIVDVPK 157 +MEYKR D+++ LPCKH+YH+GCGSRWLSINKACPICY EV+++ K Sbjct: 199 QMEYKRKDQQVTLPCKHVYHAGCGSRWLSINKACPICYTEVVINTSK 245 >ref|XP_002285497.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER isoform 1 [Vitis vinifera] gi|225435476|ref|XP_002285498.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER isoform 2 [Vitis vinifera] gi|297746341|emb|CBI16397.3| unnamed protein product [Vitis vinifera] Length = 252 Score = 84.3 bits (207), Expect = 2e-14 Identities = 35/47 (74%), Positives = 41/47 (87%) Frame = +2 Query: 17 KMEYKRGDRRMILPCKHLYHSGCGSRWLSINKACPICYKEVIVDVPK 157 +MEYKR DR + LPCKH+YH+ CG+RWLSINKACPICY EVI +VPK Sbjct: 203 QMEYKRRDRLITLPCKHVYHAACGTRWLSINKACPICYTEVIGEVPK 249 >ref|XP_004507101.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-like isoform X3 [Cicer arietinum] Length = 248 Score = 83.6 bits (205), Expect = 3e-14 Identities = 33/47 (70%), Positives = 40/47 (85%) Frame = +2 Query: 17 KMEYKRGDRRMILPCKHLYHSGCGSRWLSINKACPICYKEVIVDVPK 157 +MEYKRGD+R+ LPCKH+YH+ CG++WLSINKACPICY EV D K Sbjct: 200 QMEYKRGDKRITLPCKHVYHASCGNKWLSINKACPICYTEVFADKSK 246